DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sms and SPDS3

DIOPT Version :9

Sequence 1:NP_001287045.1 Gene:Sms / 39403 FlyBaseID:FBgn0036272 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001190527.1 Gene:SPDS3 / 835392 AraportID:AT5G53120 Length:386 Species:Arabidopsis thaliana


Alignment Length:337 Identity:73/337 - (21%)
Similarity:140/337 - (41%) Gaps:67/337 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KRGG---YIDIYMTSSDERIIEYDIDKVVFEARSPFQKIQIMHSKTLGNMLLLDELQNIAESD-L 180
            |:||   |.:..|...:...::  ::||:|:.:|.||::.:..|.|.|.:|:||.:..:.|.| .
plant    65 KKGGKAVYFNNPMWPGEAHSLK--VEKVLFKDKSDFQEVLVFESATYGKVLVLDGIVQLTEKDEC 127

  Fly   181 IYTETL----MC-----RGVENYEGK-------------------EICILGGGDGALLYELLKEN 217
            .|.|.:    :|     :.|.::..|                   ::.::|||||.:|.|:.:.:
plant   128 AYQEMIAHLPLCSISSPKNVISHLKKFSLSGFLYLVACCNKSVNLKVLVVGGGDGGVLREISRHS 192

  Fly   218 PKHVV-MLEIDELVMQTCNKYLNVICGDVLEKRKGDQYEIIVGDCVEYLKKFIAEGRKFDYVFGD 281
            ...|: :.|||::|:....|:...:.....:.|    .::.:||..|:|:| ..|| |:|.:..|
plant   193 SVEVIDICEIDKMVIDVSKKFFPELAVGFDDPR----VQLHIGDAAEFLRK-SPEG-KYDAIIVD 251

  Fly   282 LTDIPITDAPEGETWDFI-RTIFEHSFKVLKPDGKYLTHGNGSTCKVQLRLFEEQLNLLRPKVKF 345
            .:|      |.|.....: :..||...:.|||.|  :......:..:...|.|:.:::.|...|.
plant   252 SSD------PVGPALALVEKPFFETLARALKPGG--VLCNMAESMWLHTHLIEDMISICRQTFKS 308

  Fly   346 T-TTKAFVPSFMEEWLFYQVTFAXQAQVDSSAAAVATSSAPPTASHTPASHSISQEPGTVGEMLQ 409
            . ...:.||::....:.:                |..|:..|........:.|.:..|.:....:
plant   309 VHYAWSSVPTYPSGVIGF----------------VLCSTEGPAVDFKNPINPIEKLDGAMTHKRE 357

  Fly   410 LHSYTVTIHGAA 421
            |..|...:|.||
plant   358 LKFYNSDMHRAA 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmsNP_001287045.1 AdoMet_MTases 137..362 CDD:302624 58/256 (23%)
SPDS3NP_001190527.1 PLN02366 38..386 CDD:215208 73/337 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0421
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.