DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sms and ACL5

DIOPT Version :9

Sequence 1:NP_001287045.1 Gene:Sms / 39403 FlyBaseID:FBgn0036272 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_568376.1 Gene:ACL5 / 832073 AraportID:AT5G19530 Length:339 Species:Arabidopsis thaliana


Alignment Length:235 Identity:61/235 - (25%)
Similarity:115/235 - (48%) Gaps:15/235 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 TSSDERIIEYDIDKVVFEARSPFQKIQIMHSKTLGNMLLLD-ELQNIAESDLIYTETLMCRGVEN 193
            |..|:....:.::.|:.:..|.:|.|.::.:|..|.:|::| ::|:....:.||.|.|:...:..
plant    39 TIDDDLKWSFALNSVLHQGTSEYQDIALLDTKRFGKVLVIDGKMQSAERDEFIYHECLIHPALLF 103

  Fly   194 YEG-KEICILGGGDGALLYELLKENP-KHVVMLEIDELVMQTCNKYLNVICGDVLEKRKGDQYEI 256
            :.. |.:.|:|||:|:...|:||... :.|||.:||:.|:..|.::|.|.......|:    .|:
plant   104 HPNPKTVFIMGGGEGSAAREILKHTTIEKVVMCDIDQEVVDFCRRFLTVNSDAFCNKK----LEL 164

  Fly   257 IVGDCVEYLKKFIAEGRKFDYVFGDLTDIPITDAPEGETWDFIRTIFEHSFK-VLKPDGKYLTHG 320
            ::.|....|:|   ...|||.:.|||.| |:...|..:.  :.::.:::..| .|.|:|.::|..
plant   165 VIKDAKAELEK---REEKFDIIVGDLAD-PVEGGPCYQL--YTKSFYQNILKPKLSPNGIFVTQA 223

  Fly   321 NGSTCKVQLRLFEEQLNLLRPKVKFTTT-KAFVPSFMEEW 359
            ..:.......:|....|.::...|:... .|.||||.:.|
plant   224 GPAGIFTHKEVFTSIYNTMKQVFKYVKAYTAHVPSFADTW 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmsNP_001287045.1 AdoMet_MTases 137..362 CDD:302624 59/228 (26%)
ACL5NP_568376.1 PLN02823 4..338 CDD:178418 61/235 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0421
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.