DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sms and SpdS

DIOPT Version :9

Sequence 1:NP_001287045.1 Gene:Sms / 39403 FlyBaseID:FBgn0036272 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001247005.1 Gene:SpdS / 41167 FlyBaseID:FBgn0037723 Length:287 Species:Drosophila melanogaster


Alignment Length:240 Identity:67/240 - (27%)
Similarity:109/240 - (45%) Gaps:60/240 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 IDKVVFEARSPFQKIQIMHSKTLGNMLLLDE-LQNIAESDLIYTETL----MCRGVENYEGKEIC 200
            :.:|:.:.:|.||.|||:.::|.|..|:||. :|..|..:..|.|.:    :|   .:...|::.
  Fly    26 VKEVIHKEKSRFQDIQIVETETYGRCLILDGIIQCTARDEFSYQEMISFLPLC---AHPNPKKVL 87

  Fly   201 ILGGGDGALLYELLKENP--KHVVMLEIDELVMQTCNKYLNVI-CGDVLEKRKGDQYEIIVGDCV 262
            |:|||||.:..|::| :|  :.|..:|||:.|::...:||..: ||...||.|     :.:||..
  Fly    88 IVGGGDGGVAREVVK-HPLVEEVHQVEIDDRVVELSKQYLPAMACGFANEKLK-----LTIGDGF 146

  Fly   263 EYLKKFIAEGRKFDYVFGDLTDIPITDAPEGETWDFIRTIFEHSF-----KVLKPDGKYLTHGNG 322
            :|:||   ...:||.:..|.:| ||..|.         ::|:.|:     ..||.||...:.|..
  Fly   147 DYMKK---HKNEFDVIITDSSD-PIGPAV---------SLFQESYYELMKHALKDDGIVCSQGGS 198

  Fly   323 ------------STCKVQLRLFEEQLNLLRPKVKFTTTKAFVPSF 355
                        |.||...           .||.:..|.  |||:
  Fly   199 FWLDLDYIKKTMSGCKEHF-----------AKVAYAVTS--VPSY 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmsNP_001287045.1 AdoMet_MTases 137..362 CDD:302624 67/240 (28%)
SpdSNP_001247005.1 AdoMet_MTases 1..283 CDD:302624 67/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456173
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0421
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.