DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sms and srm

DIOPT Version :9

Sequence 1:NP_001287045.1 Gene:Sms / 39403 FlyBaseID:FBgn0036272 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_957328.2 Gene:srm / 394009 ZFINID:ZDB-GENE-040426-1183 Length:289 Species:Danio rerio


Alignment Length:212 Identity:63/212 - (29%)
Similarity:97/212 - (45%) Gaps:47/212 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 IDKVVFEARSPFQKIQIMHSKTLGNMLLLDELQNIAESD------LIYTETLMCRGVENYEGKEI 199
            :::|::..:|.||.:.:..|||.||:|:||.:....|.|      :|....|.|....    |::
Zfish    25 VEEVLYHKKSKFQDVMVFKSKTYGNVLILDGVIQCTERDEFSYQEMIANLPLCCHPCP----KKV 85

  Fly   200 CILGGGDGALLYELLKENP--KHVVMLEIDELVMQTCNKYLNVICGDVLEKRKG---DQYEIIVG 259
            .|:|||||.:|.|::| :|  :.||..||||.|:....|||..:.       ||   .:..:.||
Zfish    86 LIIGGGDGGVLREVVK-HPLVESVVQCEIDEDVINVSKKYLPGMA-------KGFFSPKLTLHVG 142

  Fly   260 DCVEYLKKFIAEGRKFDYVFGDLTDIPITDA--PEGETWDFIRTIFEHSFKVLKPDGKYLTHGNG 322
            |..|::||           ..|..||.|||:  |.|..    .::|:.|:..|....  |..|..
Zfish   143 DGFEFMKK-----------NQDAFDIIITDSSDPVGPA----ESLFKESYYQLMKTA--LCEGGI 190

  Fly   323 STCK-----VQLRLFEE 334
            ..|:     :.|.|.:|
Zfish   191 LCCQGECQWLHLELIKE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmsNP_001287045.1 AdoMet_MTases 137..362 CDD:302624 63/212 (30%)
srmNP_957328.2 PLN02366 1..287 CDD:215208 63/212 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0421
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.