DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sms and C52B9.8

DIOPT Version :9

Sequence 1:NP_001287045.1 Gene:Sms / 39403 FlyBaseID:FBgn0036272 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001342016.1 Gene:C52B9.8 / 182830 WormBaseID:WBGene00016868 Length:360 Species:Caenorhabditis elegans


Alignment Length:290 Identity:53/290 - (18%)
Similarity:108/290 - (37%) Gaps:80/290 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KDT---VITCRIFQHGLLTLNVEYFLPDGKEPSISFDTMRTMELILRQKFDSDRSKYLPPIKRGG 123
            |||   ::.....::|.||...:..|.:..|.|::...:.:::.:.....||.            
 Worm    86 KDTCFLIVDSYFLENGRLTTKRDLLLEENTEYSLTGVEVESVKPVSWNNLDSR------------ 138

  Fly   124 YIDIYMTSSDERIIEYDIDKVVFEARSPFQKIQIMHSKTLGNMLLLDELQNIAESDLIYTETLMC 188
                          .:.::|:|..:|  :.::.:.....:.::       |..|||         
 Worm   139 --------------NWPVNKLVINSR--YARLLVASGFIMNSL-------NFDESD--------- 171

  Fly   189 RGVENYEGKEICILGGGDGALLYELLKENPKHVVMLEIDELVMQTCNKYLNVICGDVLEKRKGDQ 253
                 ::...|..||||       ::......:..|.||..|::. .:::..|..:..:..:.|:
 Worm   172 -----HQDVLIAGLGGG-------VMSNFFSQISYLNIDTTVVEK-EEFIINIAENYFDHFETDE 223

  Fly   254 YEIIVGDCVEYLKKFIAEGRKFDYVFGDLTDIPITD--APEGETWDFIRTIFEHSFKVLKPD--- 313
            ..||..|.|:||:|:   .:|:|.:..|..:...|:  .|..||.. |:|:     ::||..   
 Worm   224 MRIINTDFVDYLRKY---DKKYDVIIVDACENKKTNVMCPVSETLK-IKTV-----QLLKKRLTL 279

  Fly   314 ------GKYLTHGNGSTCKVQLRLFEEQLN 337
                  ..::|..|..:.|....||..:.|
 Worm   280 NGILAVNVFVTQDNIKSEKEIFELFSNEFN 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmsNP_001287045.1 AdoMet_MTases 137..362 CDD:302624 42/212 (20%)
C52B9.8NP_001342016.1 AdoMet_MTases 145..>286 CDD:327401 35/180 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.