DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sms and spds-1

DIOPT Version :9

Sequence 1:NP_001287045.1 Gene:Sms / 39403 FlyBaseID:FBgn0036272 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001367196.1 Gene:spds-1 / 174914 WormBaseID:WBGene00012909 Length:366 Species:Caenorhabditis elegans


Alignment Length:234 Identity:66/234 - (28%)
Similarity:108/234 - (46%) Gaps:34/234 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 IDKVVFEARSPFQKIQIMHSKTLGNMLLLDELQNIAESD-LIYTETLMCRGV-ENYEGKEICILG 203
            :.||:|..:|.:|.:.:..|.|.||:|:||.:....|.| ..|.|.|....: .:.:.|.:.|:|
 Worm    52 VKKVLFHEKSKYQDVLVFESTTYGNVLVLDGIVQATERDEFSYQEMLAHLPMFAHPDPKRVLIIG 116

  Fly   204 GGDGALLYELLK-ENPKHVVMLEIDELVMQTCNKYL-NVICGDVLEKRKGDQYEIIVGDCVEYLK 266
            ||||.:|.|:|| |:.:.|.|.||||:|:....|:| .:.||....|     .::..||..|:||
 Worm   117 GGDGGILREVLKHESVEKVTMCEIDEMVIDVAKKFLPGMSCGFSHPK-----LDLFCGDGFEFLK 176

  Fly   267 KFIAEGRKFDYVFGDLTDIPITDAPEGETWDFIRTIFEHSF-----KVLKPDGKYLTHGNGSTCK 326
            .   ...:||.:..|.:| |:..|         .::|..|:     ..||.||  :....|....
 Worm   177 N---HKNEFDVIITDSSD-PVGPA---------ESLFGQSYYELLRDALKEDG--ILSSQGECPW 226

  Fly   327 VQLRLFEEQLNLLR---PKVKFTTTKAFVPSFMEEWLFY 362
            :.::|....::..|   |..|:..  ..||::....:.|
 Worm   227 LDMKLISTVIHSARDLFPVAKYAV--GSVPTYTSGLMGY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmsNP_001287045.1 AdoMet_MTases 137..362 CDD:302624 65/232 (28%)
spds-1NP_001367196.1 AdoMet_MTases 7..366 CDD:418430 66/234 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.