DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sms and srm

DIOPT Version :9

Sequence 1:NP_001287045.1 Gene:Sms / 39403 FlyBaseID:FBgn0036272 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_002939455.1 Gene:srm / 100489759 XenbaseID:XB-GENE-993102 Length:300 Species:Xenopus tropicalis


Alignment Length:293 Identity:75/293 - (25%)
Similarity:128/293 - (43%) Gaps:42/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 DIDKVVFEARSPFQKIQIMHSKTLGNMLLLDELQNIAESD-LIYTETLMCRGVENYEG-KEICIL 202
            ::::|::..:|.||:|.:..|||.||:|:||.|....|.| ..|.|.:....:.::.. :::.|:
 Frog    35 EVEEVLYHKQSSFQEILVFRSKTYGNVLVLDGLIQCTERDEFSYQEMIANLPLYSHPNPRKVLII 99

  Fly   203 GGGDGALLYELLKE-NPKHVVMLEIDELVMQTCNKYL-NVICGDVLEKRKGDQYEIIVGDCVEYL 265
            |||||.:|.|::|. :.:.||..||||.|:....||| .:..|     ....:..:.|||..:::
 Frog   100 GGGDGGVLREVVKHPSVESVVQCEIDEEVINVSKKYLPGMAIG-----YSSPKLTLHVGDGFQFM 159

  Fly   266 KKFIAEGRKFDYVFGDLTDIPITDAPEGETWDFIRTIFEHSFKVLKPDGKYLTHGNGSTCKVQLR 330
            |:   ....||.:..|.:| |:..|         .::|:.|:..|....  |..|....|:.:.:
 Frog   160 KQ---NQDAFDVIITDSSD-PVGPA---------ESLFKESYYQLMKTA--LREGGILCCQGECQ 209

  Fly   331 LFEEQLNLLRPKVKFTTTKAFVPSFMEEWLFYQVTFA--XQAQVDSSAAAVATSSAPPTASHTPA 393
            ..  .|:|::...:|..|           ||..|.:|   .....|........|..|:.:....
 Frog   210 WL--HLDLIKEMHQFCKT-----------LFPVVEYAYCTIPTYPSGQIGFMLCSKDPSTNFKEP 261

  Fly   394 SHSISQEPGTVGEMLQLHSYTVTIHGAAVGVQE 426
            ...:|||.   .:.:.|..|...||.||..:.|
 Frog   262 VQQLSQEQ---VDKMNLRYYNSRIHQAAFVLPE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmsNP_001287045.1 AdoMet_MTases 137..362 CDD:302624 59/225 (26%)
srmXP_002939455.1 PLN02366 15..298 CDD:215208 75/293 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.