DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pbgs and alad

DIOPT Version :9

Sequence 1:NP_001261752.1 Gene:Pbgs / 39402 FlyBaseID:FBgn0036271 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001072186.1 Gene:alad / 779632 XenbaseID:XB-GENE-962175 Length:330 Species:Xenopus tropicalis


Alignment Length:321 Identity:198/321 - (61%)
Similarity:244/321 - (76%) Gaps:2/321 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LHSGMHHATLRQLQESGCEIAPHNLMYPVFIVSNDDDVQPIASMPGISRFGLNRLKEHLEPLVAK 69
            ||||..|..||..|.|...:..:|||||:||..|.|.::.|.|:||.:|:|:|:|:..|.|||..
 Frog     7 LHSGYFHPVLRAWQCSATSLDANNLMYPIFITDNPDAIEEIPSLPGQARYGVNQLEGLLRPLVDN 71

  Fly    70 GLSSVLLFGVVDPDMKDEQASNADSAKNPVVLALPKLREWFPDLLIACDVCICPYSSHGHCGLLG 134
            ||..||:|||....:|||:.|.||:...|.:||:.::||.||.||||||||:|||:||||||:|.
 Frog    72 GLKCVLIFGVPSKVIKDERGSAADAPDTPAILAIQRIREKFPQLLIACDVCLCPYTSHGHCGILR 136

  Fly   135 ETG-LENGPSIKRIAEIAVAYAKAGAHIVAPSDMMDNRVKAIKQALIDAQM-NSVSLLAYSAKFT 197
            |.| |:|..|.:|:||:|:|||:||.||||||||||.|:.||||||:...: |.||:::|||||.
 Frog   137 EDGSLQNESSCQRLAEVALAYARAGCHIVAPSDMMDGRIGAIKQALVSNDLGNKVSVMSYSAKFA 201

  Fly   198 SNFYGPFREAAQSAPKFGDRRCYQLPSGSRSLAMRAIQRDVAEGADMLMVKPGMPYLDILRSTKD 262
            |.||||||:||||.|.||||:|||||.|:|.||:||:.|||.||||||||||||||||::|..|:
 Frog   202 SCFYGPFRDAAQSKPAFGDRKCYQLPPGARGLAIRAVDRDVREGADMLMVKPGMPYLDLVREVKE 266

  Fly   263 SYPYHTLYVYQVSGEFAMLYHAAKAGAFDLKDAVLEAMKGFRRAGADCIITYYTPFLLDII 323
            .:|...|.||.||||:|||:|.|:|.|||||.||||||.||||||||.|||||||.||..|
 Frog   267 KHPALPLAVYHVSGEYAMLWHGAQANAFDLKVAVLEAMTGFRRAGADIIITYYTPQLLQWI 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PbgsNP_001261752.1 eu_ALAD_PBGS_cysteine_rich 6..323 CDD:240128 196/318 (62%)
aladNP_001072186.1 eu_ALAD_PBGS_cysteine_rich 8..327 CDD:240128 196/318 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 385 1.000 Domainoid score I805
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H16
Inparanoid 1 1.050 396 1.000 Inparanoid score I1915
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D507462at33208
OrthoFinder 1 1.000 - - FOG0004339
OrthoInspector 1 1.000 - - oto102325
Panther 1 1.100 - - LDO PTHR11458
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3061
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.