DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and AT4G00840

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_567193.2 Gene:AT4G00840 / 826193 AraportID:AT4G00840 Length:291 Species:Arabidopsis thaliana


Alignment Length:253 Identity:73/253 - (28%)
Similarity:121/253 - (47%) Gaps:44/253 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YCDGLLMSAPHTGVF-YLTCILITGTS--ALFFAFDCPFLADSINPAIPIVGAVLYF---FTMSS 90
            :|.||.:    .|.| .|..:.:.|.|  |:..:...|.|....:.|:..:.|::.|   |.:..
plant     6 FCSGLKV----LGYFMILLVVAVVGVSYYAVVVSTWWPILIRGDHGALSALAALIIFVFHFLLIM 66

  Fly    91 LL----RTTFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYCFT 151
            ||    .|.|||||.:|.       :..:::...:||.:.|...         :|....|.||..
plant    67 LLWSYFTTVFTDPGSVPE-------HFRREMGGGDSLEAGTSTD---------QGAFGSLGYCTK 115

  Fly   152 CKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFIFSCSVTHLVL 216
            |:..:|||..|||:|..||.:.||||.|:.||||.|||:||.|||       .:.|..::..:::
plant   116 CRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFL-------FYTFLETMLDVIV 173

  Fly   217 LMKKEHEVFN-VIK--AAP---FTVIVVFICFFS-IWSVIGLAGFHTYLTTSDQTTNE 267
            |:....|.|: .||  ::|   .::::.|:..|: :.|::.....|..|.:|:.|:.|
plant   174 LLPSFIEFFSQAIKHSSSPGKLASLVLAFVLNFAFVLSLLCFVVMHISLLSSNTTSVE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 45/129 (35%)
AT4G00840NP_567193.2 zf-DHHC 4..266 CDD:303066 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.