DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and AT3G60800

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_191639.2 Gene:AT3G60800 / 825251 AraportID:AT3G60800 Length:307 Species:Arabidopsis thaliana


Alignment Length:286 Identity:78/286 - (27%)
Similarity:117/286 - (40%) Gaps:65/286 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TRKWELFAGRNKFYCDGLLMSAPHTGVFYLTCILITG-TSALFFAFDCPFLADSINPAIPIVG-- 80
            |..|.:|.     :|..|      .|:..:..:|:.| ....::|    .:..:..||:...|  
plant     7 TMAWNVFK-----FCTAL------RGLGSIMILLVLGVVGVTYYA----VVLTNYGPALSQGGLD 56

  Fly    81 -------AVLYFFTMSSLL----RTTFTDPGVIP---RASNDEAAYIEKQIEVP-NSLN-----S 125
                   .:|:.|.::.||    ...||||||:|   |.|.||    |:....| |||:     |
plant    57 SLAALTILILFHFLLAMLLWSYFSVVFTDPGVVPPNWRPSTDE----ERGESDPLNSLDFVGLQS 117

  Fly   126 PTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYR 190
            .:....||            :::|..|...:|.|..|||:|..||.:.||||.||.||||..||:
plant   118 DSSSSNPR------------VRFCRKCNQLKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK 170

  Fly   191 FFYLFLVSLAFLAVFIFSCSVTHLVLLMKKEHEVFNVIKAAPFTVIVVFICF-----FSIWSVIG 250
            :|.|||.........:....:.|.:.....|.     |...|.|:...|:.|     |:: ||:|
plant   171 YFLLFLFYTFLETTLVTLVLMPHFIAFFSDEE-----IPGTPGTLATTFLAFVLNLAFAL-SVMG 229

  Fly   251 LAGFHTYLTTSDQTTNEDLKGSFSSK 276
            ....|..|...:.||.|..:...::|
plant   230 FLIMHISLVAGNTTTIEAYEKKTTTK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 42/128 (33%)
AT3G60800NP_191639.2 DHHC 63..283 CDD:418707 66/215 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.