DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and AT3G51390

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_566950.1 Gene:AT3G51390 / 824302 AraportID:AT3G51390 Length:340 Species:Arabidopsis thaliana


Alignment Length:355 Identity:90/355 - (25%)
Similarity:143/355 - (40%) Gaps:86/355 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CCSNMAPNQRVTRKWELFAGRNKFYCDGLLMSAPHTGVFYLTCILITGTSALF----FAFDCPFL 68
            ||..:.|       |:  ..|::...:...:|.|......|..:.:.....:|    |.||..|:
plant     4 CCPFLQP-------WD--RARDQCLLNLPCLSDPVRRSSLLLKLALVALHLVFIGFLFLFDAEFI 59

  Fly    69 ADS------INPAIPIVGAVL--YFFTMSSLLRTTFTDPGVIPRASND--EAAYIEKQ------- 116
            ..:      :...|.:..|.|  ||.|..|       .||.:..|..|  ||:.:.:.       
plant    60 EKTKRDPWYMGCYILLFSATLLQYFVTSGS-------SPGYVVDAMRDVCEASAMYRNPSTTSIQ 117

  Fly   117 ----------IEVPNSLNSPTYRPP-PRTKEVL---VKGQTVKLKYCFTCKIFRPPRASHCSLCD 167
                      :.|.....|...||| |..|.||   ..|.:::...|..|.:.:|||..||..||
plant   118 HASRKSESVVVNVEGGSASCPRRPPTPWGKLVLDLYPPGTSIRNLTCGYCHVEQPPRTKHCHDCD 182

  Fly   168 NCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFIFSCSVTHLVLLMKKEHEVFNVIKAAP 232
            .||.:|||||.|:|.|:|::|:..|:.::.....|.::.....|.:|          .||.|  |
plant   183 RCVLQFDHHCVWLGTCIGQKNHSKFWWYICEETTLCIWTLIMYVDYL----------SNVAK--P 235

  Fly   233 F-----TVIVVFICFFSIWSVIGLAGFHTYLTTSDQTTNEDLKGSFSSKGGPRTQN------PYS 286
            :     .::::.|...|:..|:.|..||:||..::|:|.|.::    .:..|..:|      |:|
plant   236 WWKNAIIILLLVILAISLIFVLLLLIFHSYLILTNQSTYELVR----RRRIPYMRNIPGRVHPFS 296

  Fly   287 RGNICLNCCHILCG-------PMTPSLIDR 309
            || |..|..::.||       |....|.||
plant   297 RG-IRRNLYNVCCGNYNLDSLPTAFELEDR 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 40/128 (31%)
AT3G51390NP_566950.1 DHHC 164..>231 CDD:396215 25/76 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.