DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and AT3G18620

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_188492.2 Gene:AT3G18620 / 821393 AraportID:AT3G18620 Length:345 Species:Arabidopsis thaliana


Alignment Length:328 Identity:73/328 - (22%)
Similarity:115/328 - (35%) Gaps:123/328 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CCCCSNMAPNQRVTRKWELFAGRNKFY------------CDGLLMSAP-------HTGVFY--LT 49
            |...:|..|.:..|:.:.|...|::.:            |.|:..:.|       ..|:|:  .|
plant    42 CGAITNQNPVRPETKSFGLRRFRDRCFVVILAVFMLFVICGGIWAAYPVLFSISLACGIFHSVTT 106

  Fly    50 CILITGTSALFF--AFDCPFLADSINPAIPIVGAVLYFFTMSSLLRTTFTDPGVIPRASNDEAAY 112
            ..|...|.:.|.  ||.|.....:|          ||           .|.|||    .|     
plant   107 ATLAISTLSTFILVAFKCAGKPTNI----------LY-----------GTHPGV----GN----- 141

  Fly   113 IEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHC 177
                    .:||:.|                    :|..|...:.||..||..|..||...||||
plant   142 --------GALNNYT--------------------FCNYCSKPKSPRTHHCRTCGMCVLDMDHHC 178

  Fly   178 PWVGNCVGKRNYRFFYLFLVS-------LAFLAVF-------------IFSCSVTHL-------V 215
            |::|||||..|:::|..||:|       .|.:.|:             .::..|.|:       :
plant   179 PFIGNCVGAGNHKYFIAFLISAVISTSYAAVMCVYTLIHILPPIEKGAAYASDVAHVAHGNSISI 243

  Fly   216 LLMKKE---HEVFNVIKAAPFTVIVVFICFFSIWSVIGLAGF-----------HTYLT-TSDQTT 265
            |.:.|.   ..:.|.:..:..::::|::...|:...|||:..           .|||: .|.|.|
plant   244 LRVVKNICLTYIANAVFISVRSLVLVYLFVASVSVAIGLSVLLWQQLSYIYEGKTYLSHLSSQGT 308

  Fly   266 NED 268
            .||
plant   309 EED 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 44/165 (27%)
AT3G18620NP_188492.2 DHHC 76..>219 CDD:418707 49/200 (25%)
DHHC 149..298 CDD:396215 36/148 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.