DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and AT3G04970

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_187148.2 Gene:AT3G04970 / 819657 AraportID:AT3G04970 Length:397 Species:Arabidopsis thaliana


Alignment Length:227 Identity:66/227 - (29%)
Similarity:99/227 - (43%) Gaps:77/227 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IVGAVLYFFTMSSLLRTTFTDPGVIPRASN----------DEAAYIEKQIEVPNSLNSPTYRPPP 132
            |||.:|:       |.|.|:|||.: .|.|          |:..|.:|:                
plant   121 IVGVILF-------LLTCFSDPGTV-NAENVSRYISAYPYDDIIYSKKE---------------- 161

  Fly   133 RTKEVLVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFL- 196
                            |.||||.:|.|:.|||:|:.||.||||||.|:.||:|:||.::|..|| 
plant   162 ----------------CSTCKIPKPARSKHCSICNRCVARFDHHCGWMNNCIGERNTKYFMAFLL 210

  Fly   197 ----------VSLAF-LAVFIFSCSVTHLVLLMKKEHEVFNVIKAAP---------FTVIVVFIC 241
                      |::.| ||..:....|.|::.:.....:.|..:  ||         :...::.:.
plant   211 WHFLLCLYGTVAIGFILAGRVKELRVVHILTVYYGVDKSFRSL--APRVIQWLVGTYNTQILLMV 273

  Fly   242 FFSIWSVIGLAGF---HTYLTTSDQTTNEDLK 270
            |.:|.|:: ||||   |..|..::.||||..|
plant   274 FLAIVSLL-LAGFFAYHANLCLTNTTTNETFK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 50/147 (34%)
AT3G04970NP_187148.2 DHHC 90..>218 CDD:388695 43/136 (32%)
DHHC 155..305 CDD:366691 53/185 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.