DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and zdhhc2

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_012820452.1 Gene:zdhhc2 / 779681 XenbaseID:XB-GENE-947256 Length:367 Species:Xenopus tropicalis


Alignment Length:341 Identity:89/341 - (26%)
Similarity:136/341 - (39%) Gaps:58/341 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CPFLADSINPAIPIVGAVLYFFTMS----SLLRTTFTDPGVIPRASNDEAAYIEKQI---EVPNS 122
            |....|:|  |..|:..:.|.|.:.    |..:|.||.|  :..|.....:|.:|::   |....
 Frog    41 CIVTMDNI--AEKILCLIAYHFFLLHFVWSYWKTIFTLP--MNPAKEFHLSYSDKELLEREPRGE 101

  Fly   123 LNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKR 187
            ......|...:...|..:..:..::||..|::.:|.|..|||:||.|:.:.|||||||.||||..
 Frog   102 SQQDILRRLAKDLPVYTRTMSGAIRYCDRCQLVKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFS 166

  Fly   188 NYRFFYLFLVSLAFLAVFIFSCSVTHLVLL--------MKKEHEVFNVIKAAPFTVIVVFICFFS 244
            ||:||.|||.......:||.:..:.:.|..        ..|.|.:|....||.|:|         
 Frog   167 NYKFFLLFLAYSLLYCLFIVATDLQYFVKFWTNGLPDTQAKFHIMFLFFAAAMFSV--------- 222

  Fly   245 IWSVIGLAGFHTYLTTSDQTTNEDLKGSFSSKGGPRTQNPYSRGNICLNCCHILCG-------PM 302
              |:..|.|:|.:|...:::|.|..:......|  ..:|.:|.| ...|...:...       |:
 Frog   223 --SLSSLFGYHCWLVCKNRSTLEAFRAPVFRHG--TDKNGFSLG-FSKNLRQVFGDEKKYWLLPV 282

  Fly   303 TPSLIDRRGIATDEFIQQMQHQSSPRHALSDVL--------------SASHMVTTSQPMMGGLGG 353
            ..||.|.....|....|.::..|:|..|.:...              |.||::|.||......|.
 Frog   283 FTSLGDGCSFPTCLVNQDLEQASTPTGANTATKSIENHPFPAKPLRESQSHLLTDSQSWNENNGN 347

  Fly   354 GGIGGAGG----GISI 365
            ...|...|    |::|
 Frog   348 SEKGKLAGMSNPGLTI 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 46/131 (35%)
zdhhc2XP_012820452.1 DHHC 19..294 CDD:388695 73/270 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.