DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and zdhhc15b

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001071249.1 Gene:zdhhc15b / 777734 ZFINID:ZDB-GENE-061110-106 Length:332 Species:Danio rerio


Alignment Length:285 Identity:75/285 - (26%)
Similarity:117/285 - (41%) Gaps:72/285 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VFYLTCILITGTSALF----FAFDCPFLADSINPAIPIVGAVLYFF------------------- 86
            :|....::|..:..|:    :.|:..|:..|.|     :|.|.|..                   
Zfish    13 IFSWIPVIIISSVVLWSYYAYVFELCFVTLSNN-----LGRVTYLLIFHVCFIMFCWTYWKAIFT 72

  Fly    87 ---TMSSLLRTTFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKY 148
               |.:.....::||.   .|...:|...::|||.|..:...|          :..:.|:..:::
Zfish    73 PPSTPTKKFHLSYTDK---ERYEMEERPEVQKQILVDIAKKLP----------IFTRAQSGAIRF 124

  Fly   149 CFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFIFSCSVTH 213
            |..|::.:|.|..|||:|:.||.:.|||||||.||||..||:||.|||.......|||.|....:
Zfish   125 CDRCQVIKPDRCHHCSVCETCVLKMDHHCPWVNNCVGFSNYKFFLLFLSYSMIYCVFIASTVFQY 189

  Fly   214 LVLLM--------KKEHEVFNVIKAAPFTVIVVFICFFSIWSVIGLAGFHTYLTTSDQTTNEDLK 270
            .:...        .|.|.:|.:..|..|.|.::|           |.|:|.:|...:::|.|   
Zfish   190 FLKFWVGDLPNGPAKFHVLFLLFVALMFFVSLMF-----------LFGYHCWLVAKNRSTLE--- 240

  Fly   271 GSFSSKGGPRTQNPYSRG--NICLN 293
             :||.   |..||...|.  |:.||
Zfish   241 -AFSP---PVFQNGPDRNGFNVGLN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 45/131 (34%)
zdhhc15bNP_001071249.1 zf-DHHC 16..292 CDD:303066 74/282 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.