DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and Zdhhc4

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_082655.1 Gene:Zdhhc4 / 72881 MGIID:1920131 Length:343 Species:Mus musculus


Alignment Length:342 Identity:99/342 - (28%)
Similarity:139/342 - (40%) Gaps:90/342 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CSNMAPN--QRV--TRKWELFAGRN-KFYCDGLLMSAPHTGVFY--LTCILITGTSALFFAFD-- 64
            ||.:.|.  ||.  |...:||..|: .|....||:.    |:.|  .||.:......|.|:..  
Mouse    41 CSRVIPQCLQRAVQTLLHQLFHTRHPTFIVLHLLLQ----GLVYAEYTCEVFGYCRELEFSLPYL 101

  Fly    65 -CPFLADSINPAIPIVGAVLYFFTMSSLLRTTFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTY 128
             .|::..|:|         |.|||:     |...:||.|.:|:......:.|..:|....||   
Mouse   102 LLPYVLLSVN---------LVFFTL-----TCAANPGTITKANESFLLQVYKFDDVMFPKNS--- 149

  Fly   129 RPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFY 193
                               .|.||.:.:|.|:.||.|||.||.||||||.||.||:|..|.|:|.
Mouse   150 -------------------RCPTCDLRKPARSKHCRLCDRCVHRFDHHCVWVNNCIGAWNTRYFL 195

  Fly   194 LFLVSLAFLAVFIFSCSVTHLVLLMKKE------------HEVFNVIKAAPFTVIVVFICFFSIW 246
            ::|::|...|..|.:.:...|:.|:...            |  |..:... |.:..:|:.|..|.
Mouse   196 IYLLTLTASAATIATVTAAFLLRLVTVSDLYQETYLDDVGH--FQAVDTV-FLIQHLFLAFPRIV 257

  Fly   247 SVIG--------LAG---FHTYLTTSDQTTNEDLKG-----------SFSSKGGPRT-QNPYSRG 288
            .::|        |||   |..||..::|||||..||           ::|....||. ||.:|.|
Mouse   258 FLLGFVIVLSMLLAGYLCFALYLAATNQTTNEWYKGDWAWCQRWPLVAWSPSAEPRIHQNIHSHG 322

  Fly   289 NICLNCCHILCGPMTPS 305
             ...|...|.. |.|||
Mouse   323 -FRSNLREIFL-PATPS 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 50/146 (34%)
Zdhhc4NP_082655.1 DHHC 151..292 CDD:396215 50/143 (35%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 340..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R405
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.