DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and Zdhhc11

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_081980.1 Gene:Zdhhc11 / 71164 MGIID:1918414 Length:347 Species:Mus musculus


Alignment Length:253 Identity:69/253 - (27%)
Similarity:102/253 - (40%) Gaps:63/253 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VFYLTCILITGTSALFFAFDCPFLADSINPAIPIV-GAVLYFFTMSSLLRTTFTDPGVIPRASND 108
            :.||...::|      |....|||..|...|..|| |.|..|..:..|:..|. ||.       |
Mouse    50 ITYLAMSIVT------FGIFIPFLPYSWKYAANIVMGGVFIFHLIVHLIAITI-DPA-------D 100

  Fly   109 EAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRF 173
            ....::|....|    .|.:   .|:|...|    ::.:||..|::....:|.|||.|:.||..|
Mouse   101 TNVRLKKDYTQP----VPAF---DRSKHTHV----IQNQYCHLCEVTASKKAKHCSACNKCVSGF 154

  Fly   174 DHHCPWVGNCVGKRNYRFFYLFLVSLA--FLAVFIFSCSVTHLVLLMKKEHEVFNVIKAAPFTVI 236
            ||||.|:.||||:|||.||:..:.|.|  .|.|.|..|.:.....:...|      ::..|....
Mouse   155 DHHCKWLNNCVGRRNYWFFFWSVASAAVGILGVMIILCYICIQYFVNPDE------LRTDPLYKE 213

  Fly   237 VV----FICFFSIWSV----------------IGLAG---------FHTYLTTSDQTT 265
            ::    ::.|.|:|.|                :.:|.         ||.||.|.:.:|
Mouse   214 IISENTWLLFLSLWPVPVKTPIVLSIAVMALLLAIASFVMLGHLLIFHLYLITKNMST 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 44/151 (29%)
Zdhhc11NP_081980.1 zf-DHHC 123..277 CDD:279823 45/159 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 291..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.