Sequence 1: | NP_648561.2 | Gene: | app / 39399 | FlyBaseID: | FBgn0260941 | Length: | 755 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_081980.1 | Gene: | Zdhhc11 / 71164 | MGIID: | 1918414 | Length: | 347 | Species: | Mus musculus |
Alignment Length: | 253 | Identity: | 69/253 - (27%) |
---|---|---|---|
Similarity: | 102/253 - (40%) | Gaps: | 63/253 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 VFYLTCILITGTSALFFAFDCPFLADSINPAIPIV-GAVLYFFTMSSLLRTTFTDPGVIPRASND 108
Fly 109 EAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRF 173
Fly 174 DHHCPWVGNCVGKRNYRFFYLFLVSLA--FLAVFIFSCSVTHLVLLMKKEHEVFNVIKAAPFTVI 236
Fly 237 VV----FICFFSIWSV----------------IGLAG---------FHTYLTTSDQTT 265 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
app | NP_648561.2 | zf-DHHC | 146..270 | CDD:279823 | 44/151 (29%) |
Zdhhc11 | NP_081980.1 | zf-DHHC | 123..277 | CDD:279823 | 45/159 (28%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 291..332 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |