DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and Zdhhc24

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_081752.2 Gene:Zdhhc24 / 70605 MGIID:1917855 Length:284 Species:Mus musculus


Alignment Length:195 Identity:55/195 - (28%)
Similarity:86/195 - (44%) Gaps:36/195 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 RPPPRTKEVLVKGQTV--KLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRF 191
            |..|..:.|::.|:.:  ...||:.|:...|||:.|||.|..|:.|.||||..:|.|||..|||.
Mouse    74 RSDPSIRGVMLAGRGLGQGWAYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGCCVGFHNYRP 138

  Fly   192 FYLFLVSLAFLAVFIFSCSVTHLVLLMKKEHEVFNV-IKAAPFTVIV---VFICFFSIWSVIG-- 250
            |...|:..|.:.:.|.......|..|::....::.| :...|:.:::   |.:..|::..|:.  
Mouse   139 FLCLLLHSAGVLLHISVLLGPALSALLQAHSALYTVALLLLPWLMLLTGKVSLAQFALAFVVDTC 203

  Fly   251 LAG---------FHTYLTTSDQTTNEDLKGSFSSKGGPRTQNPYSRGNIC--LNCCHILCGPMTP 304
            :||         ||..|....|||.|                 ::||:.|  |..||.|...:.|
Mouse   204 VAGALLCGAGLLFHGMLLLRGQTTWE-----------------WARGHHCYDLGTCHNLQAALGP 251

  Fly   305  304
            Mouse   252  251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 43/138 (31%)
Zdhhc24NP_081752.2 zf-DHHC 95..232 CDD:279823 43/153 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.