DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and Zdhhc16

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_006231465.1 Gene:Zdhhc16 / 654495 RGDID:1591893 Length:377 Species:Rattus norvegicus


Alignment Length:346 Identity:77/346 - (22%)
Similarity:130/346 - (37%) Gaps:124/346 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VFYLTCILITGTSALFFAFDCPFLADSINPAIPIVGAVL--------YFFTMSSLLRTTF----- 96
            ||.:..|::|| |.:..|:.|         .:|::....        :|::..:|:...|     
  Rat    82 VFVVLVIVLTG-SIVAIAYLC---------VLPLILRTYSVPRLCWHFFYSHWNLILIVFHYYQA 136

  Fly    97 --TDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPR 159
              |.||..|:..||.|                                ||.:  |..|...:|.|
  Rat   137 ITTPPGYPPQGRNDIA--------------------------------TVSI--CKKCIYPKPAR 167

  Fly   160 ASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFIFSCS-------------V 211
            ..|||:|:.||.:.||||||:.||||..|:|:|:.|...:....|:   ||             :
  Rat   168 THHCSICNRCVLKMDHHCPWLNNCVGHYNHRYFFSFCFFMTLGCVY---CSYGSWDLFREAYAAI 229

  Fly   212 THLVLLMKKE-----HEVFNVIKAAPFT----------VIVVFICFFSIWSVIGLAGFHTYLTTS 261
            ..:..|.|.:     ::.::......|:          |.:.|:|.....::..|..:|..|.:.
  Rat   230 EKMKQLDKNKLQAIANQTYHQTPPPTFSFRERITHKSLVYLWFLCSSVALALGALTMWHAVLISR 294

  Fly   262 DQTT-----NEDLKGSFSSKGGPRT-QNPYSRGNICLNCCHILCGPMTPSLIDRRGIATDEFIQQ 320
            .:|:     |:..:....:||  |. :|||:.|  ||:...:..|      :|            
  Rat   295 GETSIERHINKKERRRLQAKG--RVFRNPYNYG--CLDNWKVFLG------VD------------ 337

  Fly   321 MQHQSSPRHALSDV-LSASHM 340
                 :.||.|:.| |.:||:
  Rat   338 -----TGRHWLTRVLLPSSHL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 38/156 (24%)
Zdhhc16XP_006231465.1 DHHC 156..305 CDD:396215 37/153 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.