DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and zdhhc18a

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001071031.1 Gene:zdhhc18a / 564062 ZFINID:ZDB-GENE-060929-424 Length:467 Species:Danio rerio


Alignment Length:302 Identity:190/302 - (62%)
Similarity:230/302 - (76%) Gaps:3/302 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NQRVTRKWELFAGRNKFYCDGLLMSAPHTGVFYLTCILITGTSALFFAFDCPFLADSINPAIPIV 79
            :||:.||||:|.|:|:|||||.:|.|...||..||..||..||.|||.||||||.|.:...||::
Zfish    32 SQRLRRKWEVFPGKNRFYCDGRIMLARQCGVLPLTIGLIFITSVLFFTFDCPFLVDHLTVFIPVI 96

  Fly    80 GAVLYFFTMSSLLRTTFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTV 144
            |.||:.|.:.|||:|:|||||::|||..||||.|||||:  || .|.||||||||||:|:..|.|
Zfish    97 GGVLFIFVVISLLQTSFTDPGILPRALPDEAADIEKQID--NS-GSSTYRPPPRTKEILINDQVV 158

  Fly   145 KLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFIFSC 209
            ||||||||::|||||.||||||||||:||||||||||||||||||||||.|:|||:||..|||.|
Zfish   159 KLKYCFTCRMFRPPRTSHCSLCDNCVERFDHHCPWVGNCVGKRNYRFFYAFIVSLSFLTSFIFGC 223

  Fly   210 SVTHLVLLMKKEHEVFNVIKAAPFTVIVVFICFFSIWSVIGLAGFHTYLTTSDQTTNEDLKGSFS 274
            .:|||.|..:..:.....|:.:|.:|:.:.||||||||::||:||||||..|:.|||||:|||:|
Zfish   224 VITHLTLRSQGGNGFIQAIQDSPASVVELVICFFSIWSILGLSGFHTYLVASNLTTNEDIKGSWS 288

  Fly   275 SKGGPRTQNPYSRGNICLNCCHILCGPMTPSLIDRRGIATDE 316
            ||.|..:.|||:..||..|||.:|||||.||||||||....|
Zfish   289 SKRGEESGNPYTYNNIFTNCCVVLCGPMPPSLIDRRGFVPPE 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 83/123 (67%)
zdhhc18aNP_001071031.1 zf-DHHC 160..284 CDD:279823 83/123 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 202 1.000 Domainoid score I2943
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264614at2759
OrthoFinder 1 1.000 - - FOG0000285
OrthoInspector 1 1.000 - - otm25516
orthoMCL 1 0.900 - - OOG6_100625
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X394
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.