DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and zdhhc20a

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_005172729.1 Gene:zdhhc20a / 561776 ZFINID:ZDB-GENE-070424-38 Length:369 Species:Danio rerio


Alignment Length:291 Identity:79/291 - (27%)
Similarity:128/291 - (43%) Gaps:39/291 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CPFLADSINPAI--PIVGAVLYFFTMSSLLRTTFTDPG------VIPRASNDEAAYIEKQIEVPN 121
            |.:...::|..:  .:|....:|..|.|..:|..:.|.      .:|:|   |....||: |.|.
Zfish    38 CIYTIPNVNEQVIYLVVFHAFFFMFMWSYWKTISSKPTNPSKEFCLPKA---EKELYEKE-ERPE 98

  Fly   122 SLNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGK 186
            : .....:...|...:.....:..::||..|::.:|.|..|||.||.||.:.|||||||.||||.
Zfish    99 A-QQDILKRVARELPIYTFTGSGAIRYCDRCQLIKPDRCHHCSTCDKCVLKMDHHCPWVNNCVGF 162

  Fly   187 RNYRFFYLFLVSLAFLAVFIFSCSVTHLV----LLMKK--EHEVFNVI--KAAPFTVIVVFI--C 241
            .||:||.|||.......|:|.:..:.:.:    |..::  ||...|.:  ..|.|.|:.:|.  .
Zfish   163 SNYKFFVLFLAYSMLYCVYIAATVLQYFIKFWTLCRRRAIEHCPENQLPDTHAKFHVLFLFFVAA 227

  Fly   242 FFSIWSVIGLAGFHTYLTTSDQTTNEDLKGSFSSKGGPRTQNPYSRGNICLNCCHIL-------C 299
            .|.| |::.|..:|.:|...::||.|..:... .:.|| .:|.::.| ...|...:.       |
Zfish   228 MFFI-SILSLFSYHLWLVGKNRTTIEAFRAPV-FRNGP-DKNGFTLG-FRKNITQVFGDQKKYWC 288

  Fly   300 GPMTPSLID-----RRGIATDEFIQQMQHQS 325
            .|:..||.|     .|.:..|.....::||:
Zfish   289 LPIFSSLGDGYTFPTRLVTVDVEHGNIEHQT 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 49/133 (37%)
zdhhc20aXP_005172729.1 zf-DHHC 12..309 CDD:303066 76/279 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.