DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and ZDHHC7

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001139020.1 Gene:ZDHHC7 / 55625 HGNCID:18459 Length:345 Species:Homo sapiens


Alignment Length:331 Identity:86/331 - (25%)
Similarity:134/331 - (40%) Gaps:102/331 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CCCCCSNMAPNQRVTRKWELFAGRNKFYCDGLLMSAPHTGVFYLTCILITGTSALFFA------F 63
            |...|:.|.        |.|.|     |.|           |.:|.:::..:...:::      |
Human    46 CGMICAVMT--------WLLVA-----YAD-----------FVVTFVMLLPSKDFWYSVVNGVIF 86

  Fly    64 DCPFLADSINPAIPIVGAVLYFFTMSSLLRTTFTDPGVIPRASND---EAAYIEKQI-------- 117
            :|                 |....:||.|||..||    |..|:|   .|..::..:        
Human    87 NC-----------------LAVLALSSHLRTMLTD----PEKSSDCRPSACTVKTGLDPTLVGIC 130

  Fly   118 -EVPNSLNSPTYRPPPR---TKEVLVKGQTVKLK------YCFTCKIFRPPRASHCSLCDNCVDR 172
             |...|:.|......|:   |||.:   ::::||      .|..|...:|.||.|||:|..|:.:
Human   131 GEGTESVQSLLLGAVPKGNATKEYM---ESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRK 192

  Fly   173 FDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVF-IFSCSVTHLVLLMKKEHEVFNVIKAAPFTVI 236
            .|||||||.||||::|.|||.||.:.:|..:|. :..|....:..:..:..|..:.  :.|.|||
Human   193 MDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHALILCGFQFISCVRGQWTECSDF--SPPITVI 255

  Fly   237 -VVFIC-----FFSIWSVIGLAGFHTYLTTSDQTTNEDLK-------------GSFSSKGGPRT- 281
             ::|:|     ||:..:|  :.|...:...:|:|..|.||             |..|..|||.: 
Human   256 LLIFLCLEGLLFFTFTAV--MFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSL 318

  Fly   282 --QNPY 285
              .||:
Human   319 LWMNPF 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 46/136 (34%)
ZDHHC7NP_001139020.1 zf-DHHC 168..295 CDD:307600 46/130 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.