DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and ZDHHC4

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001358221.1 Gene:ZDHHC4 / 55146 HGNCID:18471 Length:359 Species:Homo sapiens


Alignment Length:334 Identity:83/334 - (24%)
Similarity:138/334 - (41%) Gaps:98/334 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNLLCCCCCSNMAPNQRVTRKWELFAGRNKFYC----------DGLLMSAPHT--GVFYLTCILI 53
            |.|:..|.||.....:.:.|     .|...|.|          .|||....||  ..|.:..:::
Human    16 MGLVLICVCSKTHSLKGLAR-----GGAQIFSCIIPECLQRAVHGLLHYLFHTRNHTFIVLHLVL 75

  Fly    54 TGTSALFFAFD----CPFLADSIN----PAIPIVGAVLYFFTMSSLLRTTFTDPGVIPRASNDEA 110
            .|.....:.::    |..|..|::    |.: ::|..|:|||:     |..|:||:|.:|  :|.
Human    76 QGMVYTEYTWEVFGYCQELELSLHYLLLPYL-LLGVNLFFFTL-----TCGTNPGIITKA--NEL 132

  Fly   111 AYIE----KQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRASHCS------- 164
            .::.    .::..|.::.                        |.||.:.:|.|:.|||       
Human   133 LFLHVYEFDEVMFPKNVR------------------------CSTCDLRKPARSKHCSECGSRDS 173

  Fly   165 --------LCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFIFSCSVT---HLVLLM 218
                    :|:.||.||||||.||.||:|..|.|:|.:::::|...|..:...|.|   |||::.
Human   174 SGTSNSTCVCNWCVHRFDHHCVWVNNCIGAWNIRYFLIYVLTLTASAATVAIVSTTFLVHLVVMS 238

  Fly   219 KKEHEVF-------NVIKAAPFTVIVVFICFFSIWSVIG--------LAG---FHTYLTTSDQTT 265
            ....|.:       :|:... |.:..:|:.|..|..::|        |.|   |..||..::|||
Human   239 DLYQETYIDDLGHLHVMDTV-FLIQYLFLTFPRIVFMLGFVVVLSFLLGGYLLFVLYLAATNQTT 302

  Fly   266 NEDLKGSFS 274
            ||..:|.::
Human   303 NEWYRGDWA 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 49/159 (31%)
ZDHHC4NP_001358221.1 DHHC 151..307 CDD:366691 49/156 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R405
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.