DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and zdhhc21

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001016073.1 Gene:zdhhc21 / 548827 XenbaseID:XB-GENE-855474 Length:264 Species:Xenopus tropicalis


Alignment Length:278 Identity:68/278 - (24%)
Similarity:98/278 - (35%) Gaps:112/278 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FYLTCILITGTSALFFAFDCPFLADSINPAIPIVGAVLYF----FTMSSLLRTTFTDPGVIPRAS 106
            ||.|  |......||..||        ...|.:.....|:    |.:.||||.:..|||.:.   
 Frog    25 FYNT--LFIPKLILFPRFD--------EGQISVAAIWAYYLTSIFCIISLLRASTADPGKLQ--- 76

  Fly   107 NDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVD 171
                             :||..   |.|::.|       .:.|..|.:.||.|:.|||.|.:||.
 Frog    77 -----------------DSPKI---PLTEKEL-------WELCNKCNMMRPKRSHHCSRCGHCVR 114

  Fly   172 RFDHHCPWVGNCVGKRNYRFF---------------------YLFLVSLAF-LAVFIFSCSVTHL 214
            |.||||||:.||||:.|:..|                     |.:.:.||. ..:|||       
 Frog   115 RMDHHCPWINNCVGEDNHWLFLQLCFYTQLLSGYTLVLDFCHYYYFLPLAINWDIFIF------- 172

  Fly   215 VLLMKKEHEVFNVIKAAPFTVIVVF--ICFFSIWSVIGLAGFHTYLTTSDQTTNEDLKGSFSSKG 277
                  .||: .:::.:.|..||:|  :|......::|:        .:|.||.|.:        
 Frog   173 ------RHEL-ALLRISTFMGIVMFGGMCSLFYTQIMGI--------LTDTTTIEKM-------- 214

  Fly   278 GPRTQNPYSRGNICLNCC 295
                          .|||
 Frog   215 --------------ANCC 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 42/147 (29%)
zdhhc21NP_001016073.1 DHHC 92..216 CDD:366691 42/167 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.