DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and zdhhc3a

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001002725.1 Gene:zdhhc3a / 436998 ZFINID:ZDB-GENE-040718-484 Length:316 Species:Danio rerio


Alignment Length:261 Identity:76/261 - (29%)
Similarity:111/261 - (42%) Gaps:59/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LTCILITGTSALFFAFDCPF--LADSINPAIPIVGAVLY----FFTMSSLLRTTFTDPGVIPRAS 106
            :.|.:||.....|..|...|  |..|.|....:|...|:    |..::|..|...||||.:|: .
Zfish    43 IVCAIITWFLVFFAEFVVLFVMLIPSKNLTYSLVNGTLFNSLAFLALASHFRAMCTDPGAVPK-G 106

  Fly   107 NDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKY-CFTCKIFRPPRASHCSLCDNCV 170
            |....|||       ||.             |..||.|   | |..|...:|.||.|||:|..|:
Zfish   107 NATKEYIE-------SLQ-------------LKPGQVV---YKCPKCCSIKPDRAHHCSVCKRCI 148

  Fly   171 DRFDHHCPWVGNCVGKRNYRFFYLF-----LVSLAFLAVFIFSCSVTHLVLLMKKEHEVFNVIKA 230
            .:.|||||||.||||:.|.::|.||     |:||..|.:.:|     |.:...:.:....:....
Zfish   149 RKMDHHCPWVNNCVGENNQKYFVLFTMYICLISLHSLVMVVF-----HFLNCFEDDWTKCSTFSP 208

  Fly   231 APFTVIVVFICF----FSIWSVIGLAGFHTYLTTSDQTTNEDLK-------------GSFSSKGG 278
            ....::::.:||    |.|::.: :.|...:...:|:|..|.||             |..|:.||
Zfish   209 PATVILLILLCFEGLLFLIFTSV-MFGTQVHSICTDETGIEKLKREDPTWEKTQCWEGMKSAFGG 272

  Fly   279 P 279
            |
Zfish   273 P 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 40/133 (30%)
zdhhc3aNP_001002725.1 zf-DHHC 127..251 CDD:279823 39/129 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.