DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and zdhhc24

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001002324.1 Gene:zdhhc24 / 436596 ZFINID:ZDB-GENE-040718-8 Length:295 Species:Danio rerio


Alignment Length:219 Identity:68/219 - (31%)
Similarity:89/219 - (40%) Gaps:62/219 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PRTKEVLVKGQTV--KLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFF-- 192
            |..:.|.:.|.|:  ..:||:.|:...|||.|||..|:.||.|.||||.:.|.|||..|||:|  
Zfish    85 PSIRGVFLGGDTLGQGWRYCYNCETHTPPRCSHCYDCNVCVLRRDHHCVFFGQCVGFHNYRYFLT 149

  Fly   193 -YLFL--------VSLAFLAVFIFSCSVT-HLVLLMKKEHEVFNVIKAAPFTVIV---------- 237
             .||:        |..|.:.:||....|| |.|:|:           ..|:.::|          
Zfish   150 CLLFMWAGLLYAVVMNAEVFIFILKEGVTFHSVMLL-----------LVPWIMLVSGQVTTRAFA 203

  Fly   238 -VFI---CFFSIWSVIGLAGFHTYLTTSDQTTNEDLKGSFSSKGGPRTQNPYSRGNI-----CLN 293
             .||   |......|.....||..|....|||.|...          |:.|||.|.:     ||.
Zfish   204 FAFIADTCVVGFLLVAAFLFFHVALMLRGQTTREWYS----------TRRPYSLGTMANIRECLG 258

  Fly   294 -----CCHILCGPMTPSLIDRRGI 312
                 |.  || |:.||.:...||
Zfish   259 KNWYFCW--LC-PLIPSPLPGDGI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 49/149 (33%)
zdhhc24NP_001002324.1 zf-DHHC 100..239 CDD:279823 49/149 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.