DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and CG5880

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster


Alignment Length:218 Identity:53/218 - (24%)
Similarity:87/218 - (39%) Gaps:60/218 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 SPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNY 189
            :|...||....  ||:.    :..|..|...:|||..|||:|:.|:.:.||||||:.||||..|:
  Fly   121 TPAGHPPEGVS--LVEA----VSMCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNH 179

  Fly   190 RFFYLFL--VSLAFLAVFIFSCSVTHLVLLM------------------------------KKEH 222
            |:|:|::  .:|..|.:.:|...:.|..|.:                              ..|:
  Fly   180 RYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSGHIIPVTHPNEY 244

  Fly   223 EVFNVIKAA---PFTVI------------VVFICFFSIWSVIGLAG---FHTYLTTSDQTTNEDL 269
            :.|.:..|.   |..::            :.|:.|.::..|:.|..   :|..|.|..:|:.|..
  Fly   245 DEFVLPPAVHNLPTPIVDTDAASPGRRRALWFMAFTNVAVVLALGSLSIWHAKLITRGETSVEAH 309

  Fly   270 KGSFSSKGGPRTQ----NPYSRG 288
            ......|...:.|    |||:.|
  Fly   310 INEAERKRHLQQQRIYINPYNFG 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 42/173 (24%)
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 27/61 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.