DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and CG4956

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster


Alignment Length:170 Identity:47/170 - (27%)
Similarity:77/170 - (45%) Gaps:34/170 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GLLMSAPHTGVFYLTCILITGTSALFFAFDCPFLADSINPAIPIVGAVLYF---FTMSSLLRTTF 96
            |||  .|...:| |.|::     .|.|.::..::...|.....|...:.:|   :|:.::|...:
  Fly    39 GLL--HPFCAIF-LLCLI-----GLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTVINILGNWW 95

  Fly    97 TDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRAS 161
            .  |.:...|.| :..:|:|..                    |.|:.....||.||:...|||:.
  Fly    96 L--GCMTNTSVD-SLVLERQYP--------------------VAGEAHLWHYCSTCQKLVPPRSW 137

  Fly   162 HCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAF 201
            |||||:.|:.:.||||.:..:|:|.:|.|:|..||..|:|
  Fly   138 HCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSF 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 26/56 (46%)
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 26/55 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467545
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.