DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and CG17197

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster


Alignment Length:180 Identity:40/180 - (22%)
Similarity:74/180 - (41%) Gaps:46/180 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKR 187
            :.|.:....|:.:::....:..:..||..|:...|||:.||.||..|:.:.|.||.:..:|||..
  Fly    81 ITSTSVESLPKDRQIPEPEEEHQWHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHN 145

  Fly   188 NYRFFYLFLVSLAFLAVFIFSCSVTHLVLLMK----KEHEVFNVIK--AAPFTVIVVFIC----- 241
            |.|:|:.|.:   |:|:.......||::..:|    .:....|:.:  ..||.:::..|.     
  Fly   146 NQRYFFWFTL---FMALGTGVALATHIIATLKYFSYSDLIFLNIPRDNLPPFWLVITLILNTYVF 207

  Fly   242 ----------------------FFS------IWS----VIGLAGFHTYLT 259
                                  |:|      :|.    ::|..||.|:|:
  Fly   208 AAPVSSVLMQLSVLKNNGTLHKFYSDTYDLGLWENFKLILGGKGFWTFLS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 38/157 (24%)
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919
zf-DHHC 100..>198 CDD:279823 29/100 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467544
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.