DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and CG5196

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster


Alignment Length:241 Identity:57/241 - (23%)
Similarity:92/241 - (38%) Gaps:82/241 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PHTGVFYLTCILIT-----------GTSALFFAFDCPFLADSINPAIPIVGAVLYFFTMSSLLRT 94
            |.|.:..:.||.:|           ..|...||....||             :|......:.:..
  Fly    16 PITALSIIKCITLTTLYMNSMWWPPNKSFAGFAHQALFL-------------LLSTLATFNYVMA 67

  Fly    95 TFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRP-PPRTKEVLVKGQTVKLKYCFTCKIFRPP 158
            |.|.||::|:                      .:.| .|:..:.        |:||..|:.::.|
  Fly    68 TLTGPGLMPK----------------------QWHPKDPKDAQF--------LQYCKKCEGYKAP 102

  Fly   159 RASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFF-YLFLVSL--AFLAVFIFSCS---------- 210
            |:.||..||.||.:.||||||:.:|||..|:.:| |..|.|:  :.....:..||          
  Fly   103 RSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIYRYYY 167

  Fly   211 VTHLVLLMKKEHEVFNVIKAAPFTVIVVFICF----FSIWSVIGLA 252
            :||.:     .|     :.:..||::.:.:|.    .:|..||||:
  Fly   168 LTHGL-----AH-----LASVQFTLLSIIMCILGMGLAIGVVIGLS 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 39/124 (31%)
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 39/133 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467504
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.