DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and CG4483

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster


Alignment Length:237 Identity:55/237 - (23%)
Similarity:86/237 - (36%) Gaps:77/237 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 FFTMSSLLRTTFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYC 149
            |.|:.:.:|:....||.:|...:                       |..||:.:.      |::|
  Fly    59 FGTLYNFIRSLMVGPGFVPLKWH-----------------------PQLTKDKMF------LQFC 94

  Fly   150 FTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFIFSCSVTHL 214
            ..|..::.||:.||..|:.||.:.||||||:..|||..|...|..||       :|..|.|:...
  Fly    95 TRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFL-------LFFMSGSIHGG 152

  Fly   215 VLLMKKEHEVFNVIK-------------AAPFTVIVVFICFFSIWSVIGLAGFHTYLTT------ 260
            ::::.   .|...||             ....|...:..|.||:..::|     |.|.:      
  Fly   153 IIIVS---AVIRGIKKRWLIRYGLRHMATVHLTQTNLLACVFSLGVIMG-----TVLASIKLLYM 209

  Fly   261 ------SDQTTNED---LKGSFSSKGGPRT-----QNPYSRG 288
                  .:||..|:   .|.:|.....||.     ..||:.|
  Fly   210 QMKSILKNQTEIENWIVKKAAFRRNAYPRKGIKPFVYPYNLG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 39/151 (26%)
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 39/156 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467505
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.