DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and CG10344

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster


Alignment Length:269 Identity:65/269 - (24%)
Similarity:103/269 - (38%) Gaps:74/269 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LTCILITGTSALFFAFDCPFLADSINPAIPIVGAVLYFFTMSSLLRTTFTDPGVIPRASNDEAAY 112
            :.|.||.   |:|......|....:.||....|...:.||....:...|...|      |..|..
  Fly    15 ILCFLII---AVFLPVVFMFEIVVVLPAFHEPGGFFHTFTFLMAMFLVFNIKG------NMIACM 70

  Fly   113 IEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHC 177
            :     :..|:|.....||         ...:..:.|..|:...|||:.||..|..|:.:.||||
  Fly    71 M-----IDTSVNVKKVEPP---------SDQLNWRECGECQKLAPPRSWHCKACKVCILKRDHHC 121

  Fly   178 PWVGNCVGKRNYRF-----FYLFLVS---LAFLAVF-------IFSCSVTHLVLLMKKEHEVFNV 227
            .:.|.|:|.||:||     ||||:.|   |.:.:::       |:|..||.|.|           
  Fly   122 IYTGCCIGLRNHRFFMGFIFYLFVGSVYALVYNSIYMWVIHGHIYSNWVTVLKL----------- 175

  Fly   228 IKAAPFTVIV-------VFICFFSIWSVIGLA------GFHTYLTTSDQTTNEDLKGSFSSKGGP 279
              |.|...:|       :::.|:|: :::.||      .:|..:.         |:|..|:....
  Fly   176 --ACPMLHLVTGSFWTNMYLVFYSL-NILALAYGVLLLAYHVPIV---------LRGGVSADRTK 228

  Fly   280 RTQNPYSRG 288
            .::..|.||
  Fly   229 ESKEKYDRG 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 40/151 (26%)
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 41/149 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467543
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.