DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and CG17287

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster


Alignment Length:229 Identity:60/229 - (26%)
Similarity:104/229 - (45%) Gaps:34/229 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VGAVLYFFTMSSLL------RTTFTDPGVIP---RASNDEAAYIEKQIEVPNS---LNSPTYRPP 131
            :|.:|:|:.:...:      |..|..|..||   :.|.::...:::...:..:   ||......|
  Fly    50 IGLLLFFYHLLLFMFLWTWFRCIFVAPVRIPDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLP 114

  Fly   132 PRTKEVLVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFL 196
            ..|  ..:.|   .::||.||.|.:|.||.||..|..||.:.||||||:.|||...|:::|.|||
  Fly   115 IAT--CTIDG---LVRYCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFL 174

  Fly   197 VSLAFLAVFIFSCSVTHLVLL-------MKKEHEVFNVIKAAPFTVIVVFICFFSIWSVIGLAGF 254
            ........::|...|..|.|:       :|.:|. :|:::   :.|.::|..|..|...:.|.. 
  Fly   175 FYAEVYCFYLFCVMVYDLYLICGFEVTALKNQHS-WNILQ---YLVCILFNIFTVIMYTVSLLN- 234

  Fly   255 HTYLTTSDQTTNEDLKGSFSSKGGPRTQNPYSRG 288
                .:.::||.|....::...|| :..|.::.|
  Fly   235 ----VSRNRTTMESAYATYFLLGG-KNNNGFNLG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 42/130 (32%)
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 41/126 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467477
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.