DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and Zdhhc12

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001013257.1 Gene:Zdhhc12 / 366014 RGDID:1306593 Length:267 Species:Rattus norvegicus


Alignment Length:293 Identity:76/293 - (25%)
Similarity:124/293 - (42%) Gaps:75/293 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GLLMSAPHTGVFYLTCILITGTSALFFAFDCP----------FLADSINPAIPIVGAVLYFFTMS 89
            |:|:...||       :|..|.:.:.|..|..          ||  .:...:.::|::|.:..:|
  Rat    10 GMLVRTGHT-------VLTWGITLVLFLHDTELRQWEEQGELFL--PLTFLLLVLGSLLLYLAVS 65

  Fly    90 SLLRTTFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKI 154
            .:      |||           |:..|         |..:..|:.::..:..|.:.|:.|..|.:
  Rat    66 LM------DPG-----------YVTAQ---------PQPQEEPKEEQTAMVPQAIPLRRCRYCLV 104

  Fly   155 FRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFIFSCSVTHLVLLMK 219
            .:|.||.||..|..||.|:||||||:.||||:||:..|      :|:||:        .||:|:.
  Rat   105 LQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHPLF------VAYLAL--------QLVVLLW 155

  Fly   220 KEHEVFNVIK------------AAPFTVIVVFICFFSIWSVIGLAGFHTYLTTSDQTTNEDLKGS 272
            ..:..::.::            ...||..:: :.||::...:.||. |.||...:.||.|.:...
  Rat   156 GLYLAWSGLQFFQPWGLWLRSTGLLFTTFLL-LSFFALVVSLLLAS-HLYLVARNTTTWEFISSH 218

  Fly   273 FSSKGGPRTQNPYSRGNICLNCCHILCG-PMTP 304
            ..:....||.||:.||. ..|..|..|| |..|
  Rat   219 RIAYLRQRTSNPFDRGP-TRNLAHFFCGWPSGP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 43/135 (32%)
Zdhhc12NP_001013257.1 DHHC <123..217 CDD:396215 31/109 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.