DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and Patsas

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster


Alignment Length:266 Identity:79/266 - (29%)
Similarity:114/266 - (42%) Gaps:92/266 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 AIPIVGAVL-----YFFTMSSLLRTTFT-----DPGVIPRASNDEAAYIE--KQIEVPNSLNSPT 127
            ||||...:|     .|...::::..::.     |||.||.:|:   ||..  |||        |.
  Fly   387 AIPITWNILRRSHYCFIYWNAVMWISWAIANRRDPGYIPLSSD---AYYRAIKQI--------PY 440

  Fly   128 YRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFF 192
            :       :.|.|...:..:.|.:|:..||.||.||.:|:.||..||||||::.||||.||..:|
  Fly   441 F-------DKLKKRNVMLTRLCHSCRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNCVGLRNRMWF 498

  Fly   193 YLFLVSLAFLAVFIFSCSVTHLVLLMKKEHEVFNVIKAAPFTVIVVFICF------FSIWSVIGL 251
            :||::|:|      .:||.|                        :.|.|:      |::..|:||
  Fly   499 FLFVLSVA------VNCSFT------------------------IYFACYCVMIEGFTMLYVLGL 533

  Fly   252 ------AGFHTYLTTS-------DQTTNEDLKGSFSSKGGP-------RTQNPYSRGNICLNCCH 296
                  .|....||.:       :.||||    .|:.|..|       |.|||:|||.| ||...
  Fly   534 IEAVVFCGLGWILTCTSILHACMNLTTNE----MFNYKRYPYLRDKRGRYQNPFSRGPI-LNLLE 593

  Fly   297 -ILCGP 301
             .:|.|
  Fly   594 FFVCLP 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 44/142 (31%)
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185
DHHC 455..567 CDD:334580 45/145 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467554
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.