DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and Dnz1

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster


Alignment Length:253 Identity:62/253 - (24%)
Similarity:115/253 - (45%) Gaps:53/253 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GLLMSAPHTGVFYLTCILITGTSALFFAFDCPFLADSINPAIPIVGAVLYFFTMSSLLRTTFTDP 99
            |.::.|.:..:.::  ||.|...:|:.:|.           :.:...|::...||. .:..|:||
  Fly    18 GAVLYADYVVIRWI--ILTTMPGSLWMSFH-----------VVLFNTVVFLLAMSH-SKAVFSDP 68

  Fly   100 GVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRASHCS 164
            |.:|..:|        :::..:...:....|||.      .|.:.:...|..|:.:|||||.||.
  Fly    69 GTVPLPAN--------RLDFSDLHTTNKNNPPPG------NGHSSEWTVCTRCETYRPPRAHHCR 119

  Fly   165 LCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFIFS------------CSVTHLVLL 217
            :|..|:.|.||||||:.||||:||.::|..||:.:|.|:::..:            ||...:...
  Fly   120 ICKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWVWPCEECSQNVIETQ 184

  Fly   218 MKKEHEVFNVIKAAPFTVIVVFICFFSIWSVIGLAGFHTYLTTSDQTTNEDL--KGSF 273
            ::..|.|..::.:|.|.:.|..|....:.:::           .|:|..|.:  ||::
  Fly   185 LRMIHSVILMLVSALFGLFVTAIMVDQLHAIL-----------YDETAVEAIQQKGTY 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 40/137 (29%)
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 40/141 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467553
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.