DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and ZDHHC21

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001341047.1 Gene:ZDHHC21 / 340481 HGNCID:20750 Length:265 Species:Homo sapiens


Alignment Length:282 Identity:73/282 - (25%)
Similarity:113/282 - (40%) Gaps:79/282 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CDGLLMSAPHTGVF-YLTCILITGTSALFFAFDCPFLADSINPAIPIVGAVLY---FFTMSSLLR 93
            |.||:       || :|..|::.....||     |...:...|.|.|:  :.|   .|.:.:|:|
Human    16 CMGLI-------VFVWLYNIVLIPKIVLF-----PHYEEGHIPGILII--IFYGISIFCLVALVR 66

  Fly    94 TTFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPP 158
            .:.||||.:|           :..::|:                   |:....:.|..|.:.||.
Human    67 ASITDPGRLP-----------ENPKIPH-------------------GEREFWELCNKCNLMRPK 101

  Fly   159 RASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFF--YLFLVSLAFLAVFIFS-CSVTHLVLLMKK 220
            |:.|||.|.:||.|.||||||:.||||:.|:..|  ..|...|......:|| |...:.:.|.|:
Human   102 RSHHCSRCGHCVRRMDHHCPWINNCVGEDNHWLFLQLCFYTELLTCYALMFSFCHYYYFLPLKKR 166

  Fly   221 EHEVFNVIKAAPFTVIVVFICFFSIWSVIGLAG-FHTYL--TTSDQTTNEDLKGSFSSKGGPRTQ 282
            ..::| |.:..  ..|:....|..|..::|:.| |:|.|  ..:|.|:.|.:.            
Human   167 NLDLF-VFRHE--LAIMRLAAFMGITMLVGITGLFYTQLIGIITDTTSIEKMS------------ 216

  Fly   283 NPYSRGNICLNCCHILCGPMTP 304
                      |||..:..|..|
Human   217 ----------NCCEDISRPRKP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 44/129 (34%)
ZDHHC21NP_001341047.1 DHHC 92..217 CDD:396215 44/149 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.