DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and pfa5

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001018794.2 Gene:pfa5 / 3361262 PomBaseID:SPBC691.01 Length:312 Species:Schizosaccharomyces pombe


Alignment Length:225 Identity:57/225 - (25%)
Similarity:87/225 - (38%) Gaps:57/225 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VFYLTCILITG-TSALFFAFDCPFLADSINPAIPI----------VGAVLYFFTMSSL-----LR 93
            ||....:|.|| |..:|.|..|      ::..|.|          :..:::||..|.|     .|
pombe    22 VFPAAILLSTGYTVWVFIALIC------VDSNIKIRNGYRNLGGGIVLIIFFFITSGLAYFSYFR 80

  Fly    94 TTFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPP 158
            ..|:.|...     ....|.....:.|..|..|...|                :.|.|||.:.|.
pombe    81 VLFSSPSFC-----GNTLYTYYGFDNPIFLCGPNGAP----------------RMCGTCKCWLPD 124

  Fly   159 RASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFIFSCSV--THLVLLMKKE 221
            |:.|..:...|:.:|||:|.:||..|...|.:|||.||    |.. |..:|.|  :..:::.:..
pombe   125 RSHHSRVSMRCIRKFDHYCSFVGKDVCFSNQKFFYQFL----FYG-FSAACMVLISTAIMISRTY 184

  Fly   222 HEVFNVIKAAPFTVIVVFICFFSIWSVIGL 251
            |     .::.|.|.|  |:..||.:.|:.|
pombe   185 H-----YRSLPGTWI--FVLVFSAFGVLFL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 34/108 (31%)
pfa5NP_001018794.2 COG5273 9..283 CDD:227598 57/225 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.