DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and GABPI

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster


Alignment Length:317 Identity:79/317 - (24%)
Similarity:114/317 - (35%) Gaps:85/317 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AGRNKFYCDGLLMSAPHTGVFYLTCILITGTSALFFAFDCPFLADSINPAIPIVGAVLYFFTMSS 90
            |.|..|:...|:.|     |||:..|         |.|..|.|     ...|.....|.||:.::
  Fly   144 ATRTNFFLSWLVFS-----VFYMIII---------FEFQVPLL-----ELAPEENYALMFFSCAA 189

  Fly    91 L------------------LRTTFTD--PGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTK 135
            |                  ..||..|  ||:...:|.:|.|..:..:::.:.|:..       ..
  Fly   190 LYCLYSAKALSPLNLVSAQYGTTPKDELPGIAEASSGEEQAEAQTTLQMESVLSLD-------DD 247

  Fly   136 EV----------LVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYR 190
            ||          |:.||.   ..|..|:...|.||.||.:|..||.|.|||..|:..|:|:||| 
  Fly   248 EVGDMDTAERSGLMHGQP---NICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNY- 308

  Fly   191 FFYLFLVSLAFLAVFIFS----CSVTH----------LVLLMKKEHEVFNVIKAAPFTVIVVFIC 241
            .:|:..::|:.:|:.:.:    .|:.|          .|||.....|||.........|:..:..
  Fly   309 VWYIVGLALSEIALLLGANLTLTSICHPFMVVRPLGYPVLLPDDCSEVFEGFDLGISFVVACYAL 373

  Fly   242 FFSIWSVIGLAGFHTYLTTSDQTTNEDLKGSFSSKGGPRTQNPYSRGNICLNCCHIL 298
            ..|.:....||. ..||.....|.:|          ..||.|...|..|..|...||
  Fly   374 LISSYIAFILAR-QAYLWWKGSTLHE----------YKRTSNAAGRNRIWSNWRAIL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 39/137 (28%)
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 41/151 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467551
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.