DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and Zdhhc23

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001007461.1 Gene:Zdhhc23 / 332175 MGIID:2685625 Length:425 Species:Mus musculus


Alignment Length:234 Identity:64/234 - (27%)
Similarity:100/234 - (42%) Gaps:59/234 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 DPGVIPRASNDEAAYIEKQIEVP-----------------NSLNSPTYRPPPR--TKEVLVKGQT 143
            :||.:   |||::. ...|||.|                 .|||:.|.:...|  ::..|.....
Mouse   185 NPGYL---SNDKSP-SNSQIECPVKKGQEKTKGFPGTDASGSLNNRTLKDDVRGSSRVGLDSPAK 245

  Fly   144 VKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFIFS 208
            ||..:|..|::.||.||.||.:|..||.|.||||.|:.:|||:.|::.|.|.|  ..||...::.
Mouse   246 VKEDWCAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESNHQAFILAL--SIFLLTSVYG 308

  Fly   209 CSVTHLVLLMKKEHEVFNVIKAAP-----FTVIVVFICFFSIW-SVIGLAGFHTY------LTTS 261
            .|:|  :..:.::..:|..:...|     ::..:.|.|   :| |||..||. .|      :..|
Mouse   309 ISLT--LNTICRDRSLFTALFYCPGVYANYSSALSFTC---VWYSVIITAGM-AYIFLIQLINIS 367

  Fly   262 DQTTNEDLKGSFSSKGGPRTQNPYSRGNICLNCCHILCG 300
            ...|..:::.:...|.|.|                :|||
Mouse   368 YNVTEREVQQALRQKTGRR----------------LLCG 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 41/135 (30%)
Zdhhc23NP_001007461.1 DHHC 248..374 CDD:396215 41/133 (31%)
Interaction with NOS1. /evidence=ECO:0000250 422..425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.