DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and zdhhc6

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001191086.1 Gene:zdhhc6 / 324468 ZFINID:ZDB-GENE-030131-3189 Length:412 Species:Danio rerio


Alignment Length:239 Identity:59/239 - (24%)
Similarity:96/239 - (40%) Gaps:74/239 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 HTG-VFYLTCILITGTSAL------FFAFDCPFLADSINPAIPIVGAVL----YFFTMSSLLRTT 95
            |.| :..||.|.:..:.|:      ::..|.  ...|||..:.|...||    ||..|       
Zfish    21 HWGPIIALTVIGVCSSMAILDSIIWYWPLDT--TGGSINFIMLINWTVLILYNYFNAM------- 76

  Fly    96 FTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRA 160
            |..||.||         :|.:              |.:.::::.      |::|..|:.::.||:
Zfish    77 FVGPGYIP---------LEWK--------------PEKQQDIMY------LQFCRLCQGYKAPRS 112

  Fly   161 SHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFIFSCSVTHLVLLMKKEHEVF 225
            .||..|:.||.:.||||||:.||.|..|:.:|..||: ||.|     .|....|:.:|....:::
Zfish   113 HHCRKCNRCVMKMDHHCPWINNCCGHLNHAYFTSFLL-LAPL-----GCIHAALIFIMTMYTQLY 171

  Fly   226 NVI-----------KAA--------PFTVIVVFICFFSIWSVIG 250
            :.|           .||        ||::.......|::...:|
Zfish   172 DRISFGWSSVKIDMSAARHIHHPIMPFSIAAFAATLFALGLALG 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 36/124 (29%)
zdhhc6NP_001191086.1 DHHC 95..241 CDD:396215 36/133 (27%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9H6R6 409..412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.