Sequence 1: | NP_648561.2 | Gene: | app / 39399 | FlyBaseID: | FBgn0260941 | Length: | 755 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001191086.1 | Gene: | zdhhc6 / 324468 | ZFINID: | ZDB-GENE-030131-3189 | Length: | 412 | Species: | Danio rerio |
Alignment Length: | 239 | Identity: | 59/239 - (24%) |
---|---|---|---|
Similarity: | 96/239 - (40%) | Gaps: | 74/239 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 HTG-VFYLTCILITGTSAL------FFAFDCPFLADSINPAIPIVGAVL----YFFTMSSLLRTT 95
Fly 96 FTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRA 160
Fly 161 SHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFIFSCSVTHLVLLMKKEHEVF 225
Fly 226 NVI-----------KAA--------PFTVIVVFICFFSIWSVIG 250 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
app | NP_648561.2 | zf-DHHC | 146..270 | CDD:279823 | 36/124 (29%) |
zdhhc6 | NP_001191086.1 | DHHC | 95..241 | CDD:396215 | 36/133 (27%) |
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9H6R6 | 409..412 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |