DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and Zdhhc15

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001034190.1 Gene:Zdhhc15 / 317235 RGDID:1562075 Length:337 Species:Rattus norvegicus


Alignment Length:302 Identity:80/302 - (26%)
Similarity:133/302 - (44%) Gaps:68/302 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RKWELFAGRNKFYCDGLLMSAPHTGVFYLTCILITGTSALFFAFD-CPFLADSINPAIPIVGAVL 83
            |.|::........|..:|...|     .|..:|:...|...:.|: |  |...::||..::..:|
  Rat     3 RGWKMALSGGLRCCRRVLSWVP-----VLVIVLVVLWSYYAYVFELC--LVTVLSPAEKVIYLIL 60

  Fly    84 Y--------------FFTM----SSLLRTTFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRP 130
            |              .||:    :.....::||.   .|..|:|...::||:.|..:...|.|  
  Rat    61 YHAIFVFFAWTYWKSIFTLPQQPNQKFHLSYTDK---ERYKNEERPEVQKQMLVDMAKKLPVY-- 120

  Fly   131 PPRTKEVLVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLF 195
             .||....|       ::|..|.:.:|.|..|||:|..||.:.|||||||.||:|..||:||..|
  Rat   121 -TRTGNGAV-------RFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQF 177

  Fly   196 L----VSLAFLAVFIFSCSVTH----LVLLMKKEHEVFNVIKAAPFTVIVVFI-CFFSIWSVIGL 251
            |    :...::|..:||..:.:    |..:..|.|.:|           ::|: |.|.: |::.|
  Rat   178 LAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLF-----------LLFVACMFFV-SLVIL 230

  Fly   252 AGFHTYLTTSDQTTNEDLKGSFSS---KGGPRTQNPYSRGNI 290
            .|:|.:|.:.::||.|    :|.:   ..||. :|.::.|.|
  Rat   231 FGYHCWLVSRNKTTLE----AFCTPVFTSGPE-KNGFNLGFI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 44/132 (33%)
Zdhhc15NP_001034190.1 zf-DHHC <125..308 CDD:303066 51/167 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..337
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.