DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and Zdhhc20

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_006252134.1 Gene:Zdhhc20 / 305923 RGDID:1305755 Length:444 Species:Rattus norvegicus


Alignment Length:298 Identity:84/298 - (28%)
Similarity:125/298 - (41%) Gaps:55/298 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NMAPNQRVTRKWELFAGRNKFYCDGLLMSAPHTGVFYLTCILITGTSALFFAFDCPFLADSINPA 75
            ||||       |.|:.     .|..::...|   |.::|.:::..    ::|:.......:::..
  Rat    59 NMAP-------WTLWR-----CCQRVVGWVP---VLFITFVVVWS----YYAYVVELCVSTVSRT 104

  Fly    76 IPIVGAVLY------FFTMS--SLLRTTFTDPGVIPR---ASNDEAAYIEKQIEVPNSLNSPTYR 129
            ......|:|      ||.|.  |...|.||.|....:   .||.|....||  |..........|
  Rat   105 GEKGKTVVYLVAFHLFFVMFVWSYWMTIFTSPASPSKEFYLSNSEKERYEK--EFSQERQQDILR 167

  Fly   130 PPPRTKEVLVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYL 194
            ...|...|.....:..::||..|::.:|.||.|||.||.||.:.|||||||.||||..||:||.|
  Rat   168 RAARDLPVYTTSASKAIRYCEKCQLIKPDRAHHCSACDRCVLKMDHHCPWVNNCVGFTNYKFFML 232

  Fly   195 FLVSLAFLAVFIFSCSVTHLV----LLMKKEHEVFNVIKAAPFTVI-------------VVFICF 242
            ||:......:|:.:..:.:.:    |..:|..|  |..|..| ||:             |:|:.|
  Rat   233 FLLYSLLYCLFVAATVLEYFIKFWTLCRRKSTE--NCPKNEP-TVLTFPSAKFPSAKFHVLFLFF 294

  Fly   243 FSIW---SVIGLAGFHTYLTTSDQTTNEDLKGSFSSKG 277
            .|..   ||:.|..:|.:|...::||.|..:....|.|
  Rat   295 VSAMFFVSVLSLFSYHCWLVGKNRTTIESFRAPMFSYG 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 52/143 (36%)
Zdhhc20XP_006252134.1 zf-DHHC 75..380 CDD:303066 77/270 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.