DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and Zdhhc9

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001034105.2 Gene:Zdhhc9 / 302808 RGDID:1561389 Length:364 Species:Rattus norvegicus


Alignment Length:344 Identity:185/344 - (53%)
Similarity:239/344 - (69%) Gaps:14/344 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SNMAPNQRVTRKWELFAGRNKFYCDGLLMSAPHTGVFYLTCILITGTSALFFAFDCPFLADSINP 74
            |.|...::||||||...|||.|.|||.:|.|...|:||||..||.||..|||||:|.:||..::|
  Rat     2 SVMVIRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYLAVQLSP 66

  Fly    75 AIPIVGAVLYFFTMSSLLRTTFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLV 139
            |||:..|:|:.|:|::||||:|:||||||||..||||:||.:||..|.......|||||.|...:
  Rat    67 AIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQI 131

  Fly   140 KGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAV 204
            ..|.||||||:||||||||||||||:|||||:|||||||||||||||||||:||||::||:.|.:
  Rat   132 NNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTI 196

  Fly   205 FIFSCSVTHLVLLMKKEHEV--FNVIKAAPFTVIVVFICFFSIWSVIGLAGFHTYLTTSDQTTNE 267
            ::|:.::.::.|   |..::  ...:|..|.||:.|.||||::|||:||.||||:|...:|||||
  Rat   197 YVFAFNIVYVAL---KSLKIGFLETLKETPGTVLEVLICFFTLWSVVGLTGFHTFLVALNQTTNE 258

  Fly   268 DLKGSFSSKGGPRTQNPYSRGNICLNCCHILCGPMTPSLIDRRGIATDEFIQQMQHQSSPRHALS 332
            |:|||::.|.  |.|||||.|||..|||.:||||:.||::|||||...|  :......|.:...|
  Rat   259 DIKGSWTGKN--RVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLE--ESGSRPPSTQETSS 319

  Fly   333 DVL-----SASHMVTTSQP 346
            .:|     |..||.:...|
  Rat   320 SLLPQSPASTDHMNSNETP 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 77/125 (62%)
Zdhhc9NP_001034105.2 zf-DHHC 138..261 CDD:279823 77/125 (62%)
ANXA2R <284..>343 CDD:292349 20/57 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 201 1.000 Domainoid score I2911
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264614at2759
OrthoFinder 1 1.000 - - FOG0000285
OrthoInspector 1 1.000 - - otm46312
orthoMCL 1 0.900 - - OOG6_100625
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X394
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.