DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and Zdhhc25

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001034422.1 Gene:Zdhhc25 / 300323 RGDID:1598341 Length:279 Species:Rattus norvegicus


Alignment Length:310 Identity:85/310 - (27%)
Similarity:127/310 - (40%) Gaps:103/310 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PNQRVTRKWELFAGRNKFYCD--GLLMSAPHTGVFYLTCILITGTSALFFAFDCPFLADSINPA- 75
            ||||.   |        |..|  |:|            |.:  .|.||..:.....:.|.:.|: 
  Rat    24 PNQRC---W--------FILDPIGIL------------CAM--ATWALVLSGGWVLVRDLLIPSN 63

  Fly    76 --IPIVGAVLYFFTMSSL-----LRTTFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPR 133
              :.||...:.|..::||     |||..||||.:|..:                      ||.|.
  Rat    64 NMLYIVANGMIFHLLASLALVSHLRTMLTDPGSVPLGN----------------------RPGPD 106

  Fly   134 TKEVLVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVS 198
            |           :.||..|:...|.||:||::|..|:.:.|||||||.||||:.|.::|.||::.
  Rat   107 T-----------VSYCPDCRSAIPKRAAHCAVCKRCIRKNDHHCPWVNNCVGEDNQKYFLLFIMY 160

  Fly   199 LAFLAVFIFSCSVTHLVLLM---------KKEHE-VFNVIKAAPFT-VIVVFICFFSIWSVIGLA 252
            :..        |.||::||:         :.|.: ..:|...||.. :::|.:..|.:.||:...
  Rat   161 IGL--------SGTHVLLLLGIPVLCSYARGEWDSSSSVSPPAPILFLLLVALMGFVLSSVMLCT 217

  Fly   253 GFHTYLTTSDQTTNEDLKGSFSSKGGPRTQNPYSRGNICLNCCHI--LCG 300
            ...|..|  |:||.|.|           .||.:|.||.. .|.::  :||
  Rat   218 QMCTIYT--DKTTTELL-----------YQNTHSPGNRA-KCANLKAICG 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 44/134 (33%)
Zdhhc25NP_001034422.1 zf-DHHC 109..230 CDD:279823 43/130 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.