DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and ZDHHC1

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_037436.1 Gene:ZDHHC1 / 29800 HGNCID:17916 Length:485 Species:Homo sapiens


Alignment Length:149 Identity:48/149 - (32%)
Similarity:65/149 - (43%) Gaps:32/149 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 YCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFIFSCSVT 212
            :|..|.:....|:.|||.|:.||..|||||.|:.||||:||||.| |..|:.|.|.|.:.....|
Human   135 HCNLCNVDVSARSKHCSACNKCVCGFDHHCKWLNNCVGERNYRLF-LHSVASALLGVLLLVLVAT 198

  Fly   213 HLVL--------LMKKEHEVFNVIK-----------AAPF-TVIVVFICFFSIWSVIGLAG---- 253
            ::.:        |....|  |.|:|           |||. |.....:...::..::||..    
Human   199 YVFVEFFVNPMRLRTNRH--FEVLKNHTDVWFVFLPAAPVETQAPAILALAALLILLGLLSTALL 261

  Fly   254 -----FHTYLTTSDQTTNE 267
                 ||.||.....||.|
Human   262 GHLLCFHIYLMWHKLTTYE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 48/149 (32%)
ZDHHC1NP_037436.1 Mediates interaction with STING1. /evidence=ECO:0000269|PubMed:25299331 1..271 43/138 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
zf-DHHC 129..284 CDD:307600 48/149 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..358
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 462..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.