DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and Zdhhc1

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_008770707.1 Gene:Zdhhc1 / 291967 RGDID:1589775 Length:502 Species:Rattus norvegicus


Alignment Length:462 Identity:99/462 - (21%)
Similarity:145/462 - (31%) Gaps:141/462 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 YCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFIFSCSVT 212
            :|..|.:....|:.|||.|:.||..|||||.|:.||||:||||.| |..|:.|.|.|.:.....|
  Rat   132 HCNLCDVDVSARSKHCSACNKCVCGFDHHCKWLNNCVGERNYRLF-LHSVASALLGVLLLVLVAT 195

  Fly   213 HLVL--------LMKKEHEVFNVIKAAPFTVIVVFICFFSIWSVIGLAGFHTYLTTSDQTTNEDL 269
            ::.:        |...:|  |.|:|.           ...:|.|                     
  Rat   196 YVFVEFFVNPMRLRTNQH--FEVLKN-----------HTDVWFV--------------------- 226

  Fly   270 KGSFSSKGGPRTQNPYSRGNICLNCCHILCGPMTPSLIDR----------RGIATDEFIQQMQHQ 324
               |.......||.|   ..:.|....||.|.::.:|:..          ..:.|.|:|.|.:..
  Rat   227 ---FLPAAPVETQAP---AILALAALLILLGLLSTALLGHLLCFHIYLMWHKLTTYEYIVQHRPA 285

  Fly   325 SSPRHALSDVLSASHMVTTSQPMMGGLGGGGIGGAGGGISIGGAELKPRFYDESNPSSSTLEGNG 389
            ...:....::.|....:.:.|.|                     |...|.:....|..|. :...
  Rat   286 QEAKETHKELESCPRKMRSIQEM---------------------EFYMRTFSHVRPEPSG-QARP 328

  Fly   390 GAINGHGNGHGNGFDHPPPSYDLVQNGKSRKHHQQRCSLQTLLPASAQQQFKASKHKHKQLKQHL 454
            .|:|.:            ||..|...|:          ::..||:|:..               |
  Rat   329 AALNAN------------PSQFLATQGQ----------VEPPLPSSSDT---------------L 356

  Fly   455 VAAELQQHEGGPGPGPNSPSLLRSPATSSSYRL----NLKRSLHLPLTPSYDDVRHSPLPLLHHH 515
            ......|.:.|.......|..|:.......|||    .:.|.|.||      .:|.:..|..|..
  Rat   357 ALPPRIQPQWGLETQATLPLSLQEKRKRRVYRLPRSGTMDRELRLP------KLRDTGTPSRHAS 415

  Fly   516 VHAQQTTAIGTVAAAAAAVASGASGTNTGTGTGTGGSSSSATTTAPTSVSVSLATAPPPLAPRRP 580
            ..:..|:|....|..:....|.||           ..|......|.|.:..:...||.  |..|.
  Rat   416 PSSDSTSASPAHAGCSVDAYSSAS-----------AESMEEIPVAQTRLGSAALGAPG--AGGRE 467

  Fly   581 STLQLQA 587
            |.|.|||
  Rat   468 SRLALQA 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 37/129 (29%)
Zdhhc1XP_008770707.1 DHHC 126..281 CDD:396215 49/189 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.