DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and AT2G14255

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_973453.2 Gene:AT2G14255 / 2745525 AraportID:AT2G14255 Length:536 Species:Arabidopsis thaliana


Alignment Length:284 Identity:76/284 - (26%)
Similarity:125/284 - (44%) Gaps:35/284 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NKFYCDGLLMSAPHTGVFYLTCILITGTSALFFAFDCPFLADSINPAI-PIVGAVLYF------F 86
            :|.:|..|..::....:|.|..||:.       .|....::.|..|.| .:||....|      :
plant   258 DKIFCGKLGETSYAPMLFSLIVILMV-------LFITSIVSASNLPKITAMVGLWACFGLSCGVY 315

  Fly    87 TMSSLLRTTFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYCFT 151
            .:.:..|.:..|||.:.|.....:.:......:..:..:|::           ||...:|  |.|
plant   316 ALITFYRVSRKDPGYVKRTGEANSQHTANDPLIDINFKNPSW-----------KGNWSQL--CPT 367

  Fly   152 CKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFIFSCSVTHLVL 216
            |||.||.|:.||..|..||::|||||||:.|||||:|.|:|.:|::..|..:....:.:|..|..
plant   368 CKIIRPVRSKHCPTCKRCVEQFDHHCPWISNCVGKKNKRYFLVFVIMGALTSFVGGTTAVQRLWR 432

  Fly   217 LMKKEHE----VFNVIKAAPFTVIVVFICFFSIWSVIGLAGFHTYLTTSDQTTNEDLKGS-FSSK 276
            .:.:.|.    :.:::...|...:.:|.......:.:.|....:|:...:.||||..... ||..
plant   433 GIPQVHHGESWIKHIVIEHPDAAVFLFFDLLIFIATMTLTISQSYMIARNITTNELWNAKRFSYL 497

  Fly   277 GGP--RTQNPYSRGNICLNCCHIL 298
            .||  |..|||:.| :..||...|
plant   498 RGPDGRFYNPYNHG-LRRNCTDFL 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 42/127 (33%)
AT2G14255NP_973453.2 Ank_4 28..78 CDD:290365
ANK repeat 57..88 CDD:293786
ANK 57..85 CDD:197603
Ank_2 62..188 CDD:289560
ANK 85..211 CDD:238125
ANK repeat 92..155 CDD:293786
Ank_5 110..165 CDD:290568
ANK repeat 157..188 CDD:293786
Ank_5 176..233 CDD:290568
ANK repeat 190..214 CDD:293786
ANK repeat 225..254 CDD:293786
zf-DHHC 363..492 CDD:279823 42/130 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.