DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and ZDHHC23

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001307395.1 Gene:ZDHHC23 / 254887 HGNCID:28654 Length:435 Species:Homo sapiens


Alignment Length:299 Identity:76/299 - (25%)
Similarity:123/299 - (41%) Gaps:71/299 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PIVGAVL---YFFTMSSLLRTTFTDPGVIPRASNDEAAYIEKQIE-----------------VPN 121
            |:..|||   .|..:.:|.|.. .:||.:...::.:.:....|:|                 :..
Human   168 PVQLAVLTCGLFLILLALHRAK-KNPGYLSNPASGDRSLSSSQLECLSRKGQEKTKGFPGADMSG 231

  Fly   122 SLNSPTYRPPPRTKEVLVKGQTVKLK--YCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCV 184
            |||:.|.:..|:....:..|...|.|  :|..|::.||.||.||.:|..||.|.||||.|:.:||
Human   232 SLNNRTTKDDPKGSSKMPAGSPTKAKEDWCAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCV 296

  Fly   185 GKRNYRFFYLFLVSLAFLAVFIFSCSVTHLVLLMKKEHEVFNVIKAAP-----FTVIVVFICFFS 244
            |:.|::.|.|.|  |.||...::..::|  :..:.::..||..:...|     ::..:.|.|   
Human   297 GESNHQAFILAL--LIFLLTSVYGITLT--LDTICRDRSVFTALFYCPGVYANYSSALSFTC--- 354

  Fly   245 IW-SVIGLAGFHTY------LTTSDQTTNEDLKGSFSSKGGPRTQNPYSRGNICLNCCHILCGPM 302
            :| |||..||. .|      :..|...|..:::.:...|.|.|                :|||  
Human   355 VWYSVIITAGM-AYIFLIQLINISYNVTEREVQQALRQKTGRR----------------LLCG-- 400

  Fly   303 TPSLIDRRGIATDEFIQQMQHQSSP------RHALSDVL 335
               ||...|.....|::.. ||.|.      .|...|::
Human   401 ---LIVDTGQYNRGFLRNW-HQFSTLGTRAFHHPAEDIV 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 43/137 (31%)
ZDHHC23NP_001307395.1 MerC 96..>151 CDD:281231
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 215..255 6/39 (15%)
zf-DHHC 258..384 CDD:279823 42/133 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.