DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and swf1

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_596556.1 Gene:swf1 / 2539719 PomBaseID:SPBC13G1.07 Length:356 Species:Schizosaccharomyces pombe


Alignment Length:259 Identity:71/259 - (27%)
Similarity:106/259 - (40%) Gaps:80/259 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VFYLTCILITGTSALFFAFDCPFLAD-SINPAIPIVGAVLYFFTMSSLLRTTFTDPGVIPRASND 108
            |.:|...|||...|.||.:....... ||...|.::.:||..:.  ||.....::||.|...:.:
pombe    80 VVFLYLALITIGIASFFIYGSSLTQKFSIIDWISVLTSVLLPYI--SLYIAAKSNPGKIDLKNWN 142

  Fly   109 EAAY---IEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCV 170
            ||:.   .:.:|..||.                          |.|||..:|.|:.||.||:.||
pombe   143 EASRRFPYDYKIFFPNK--------------------------CSTCKFEKPARSKHCRLCNICV 181

  Fly   171 DRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFIFSCSVT---HLVL---------------- 216
            ::|||||.|:.||||..|.|:|:|||:           |::.   |.:|                
pombe   182 EKFDHHCIWINNCVGLNNARYFFLFLL-----------CTIQLLFHSILRLGYHFNALRDMRQYP 235

  Fly   217 --------LMKKEHEVFNVIKAAPFTVIVVFICFFSIWSVIGLAGFHTYLTTSDQTTNEDLKGS 272
                    .:|.|.|:.:|.       ::..||  |: .|:.|.|:..:|..:..||||..|.|
pombe   236 SFLRSWWFAIKSEGELGSVF-------LISLIC--SV-LVLCLLGYEFFLVYAGYTTNESEKWS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 46/150 (31%)
swf1NP_596556.1 COG5273 47..356 CDD:227598 71/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R405
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.